KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_186935Help
Entry
CHLREDRAFT_186935 CDS       T01039                                 

Gene name
RPA30
Definition
replication protein A 30 kDa subunit
Orthology
K10739  
replication factor A2
Organism
cre  Chlamydomonas reinhardtii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CHLREDRAFT_186935 (RPA30)
   03420 Nucleotide excision repair
    CHLREDRAFT_186935 (RPA30)
   03430 Mismatch repair
    CHLREDRAFT_186935 (RPA30)
   03440 Homologous recombination
    CHLREDRAFT_186935 (RPA30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 292 aa AA seqDB search
MNFGAYGDAGASQFGGGGFMPSPAPGHDNQYGGGGGGQQKGRNQNNSLRAFTIRHLLKET
ASTEDDRVKADGHEISTVTILGKVTSYRELSTRVQLQLHDGTASMEVCSWVDDADMQAQK
PVEWQVGKYVRVYGNLKTFEGKRSLTAFAVKPVTDHNEVTYHFLQCVMQHLHLTKGTPPT
GQPLPGKAAPAFGSTPAATAPYGAAGGYGGAAPAAAAPAGGDIHSDLKAVYNLPHAMAAP
NGLSVEAAHAELQRMGRAHYNLQQVMQACEYLAAEGVLYSTVNDTTFKSTGA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaactttggcgcttacggagatgctggtgctagccagtttggtggcggtggctttatg
ccgagcccagcaccaggccacgataaccaatacggcggtggcggtggcggacagcagaag
gggcgcaaccagaacaactcgctgcgcgccttcaccatccgccacctactgaaggagacc
gccagcactgaagatgaccgcgtcaaagctgatgggcacgagatctcgaccgtgacgatt
ctgggcaaggtgacctcgtaccgggagctgtcgacacgggtgcagctgcagctgcatgac
ggcaccgccagcatggaggtctgcagctgggtggacgacgccgacatgcaggcccagaag
ccggtggagtggcaggtgggcaagtacgtgcgcgtgtacggcaacctcaagaccttcgag
gggaaacgcagcctcaccgccttcgccgtcaagcctgtgacagaccacaacgaggtgacg
taccacttcctgcagtgcgtcatgcagcacctgcacctgaccaagggcacgccgcccacc
ggccagccgctgccgggcaaggccgcgcccgccttcggcagcacccccgccgccacggca
ccctacggcgctgcgggtggctacggaggcgctgcgcctgctgccgcggcccccgctggc
ggcgacatccactcggacctcaaggccgtgtacaacctgccgcacgccatggccgcgccc
aacggcctgtcagtggaggcggcgcacgccgagctgcagcgcatgggccgcgcccactac
aacctgcagcaggtcatgcaggcgtgcgagtacctggcggcggagggtgtgctgtacagc
actgtcaacgacaccaccttcaagtccactggcgcctga

DBGET integrated database retrieval system