KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_187168Help
Entry
CHLREDRAFT_187168 CDS       T01039                                 

Gene name
AEP1
Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cre00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cre00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 388 aa AA seqDB search
MRILAGVLIGSSVALAALAALKVRGLRAQSSSWHASLPVFKLKNANGMEVHVSTFGAAIL
KVVVPDKAGKKADVVLGYASVDEYETANPVTYFGVVVGRVANRIAGAKFSLGGVDYRLLA
NNGPNALHGGLKGLHKRRWEGRKVHDHDGNESVQLHYTSPEGEEGYPGTLHVQVTYTLLR
HSNELHTSIVATTDEATPVNIAQHSYFNLAGHASGSILGHTLRLVGADHYTPVGATLIPT
GEIAPVAGTPFDFTAPQTIGSRIDKVPGAAPGGYDHNFVLFGMGPQAKFITKNGMASDKP
KLAASLVDPSSGRAMDVLTTAPGVQFYSGNFLDGTTVGKGGVRYGKHAGLCLETQGFPNA
INEPKFPSIVLQPQDTYHHEIVYRFYNV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcctagcgggcgtgcttattggctcgagcgtggcccttgcagcactcgctgct
cttaaagtccggggcctccgggcacaaagctcgtcttggcacgccagcctgccggtcttc
aagctaaagaatgcaaacggcatggaggtgcacgtctccacgtttggtgcagccatcctc
aaggtcgttgtgccggataaagcgggcaagaaggcggatgtggtgctcggctacgcaagt
gtggatgagtatgagaccgccaaccccgtcacctacttcggtgtggtggtgggccgcgtg
gccaaccgcatcgccggcgccaagttctcgctgggcggcgttgactaccgcctgctcgcc
aacaacggccccaacgcactgcatggtggcctgaagggtctgcacaagcgccgctgggag
ggtcggaaggtccacgaccacgacggcaatgagtcggttcagctgcactacaccagcccc
gagggagaggagggctaccccggcacgctgcacgtgcaggtcacctacacgctgctgcgc
cactccaacgagctgcacacaagcatcgtggccaccacagacgaggccacgccggtcaac
atcgcgcagcacagctacttcaacctggccggccacgcctcgggctccatcctgggtcac
acgctgcgcctggtgggcgccgaccactacacgccggtgggggccacgctcatccccacg
ggcgagatcgcgccggtggcgggcacgccctttgacttcacggcgccacagaccatcggc
agccgcattgacaaggtgcctggcgcggcccccggcggctacgaccacaacttcgttctg
ttcggcatggggccgcaggccaagttcatcaccaagaacggcatggcgtcagacaagccc
aagctggccgcctccctggtggaccccagcagcggccgagccatggacgtgctcaccacc
gcgcccggcgtgcagttctactctggcaatttcctcgatggcaccacggtgggcaagggc
ggcgtgcggtacggcaagcacgcggggctgtgcctggagactcagggcttccccaacgcc
atcaacgagcccaagtttcccagcatcgtgctgcagccccaggacacgtaccaccacgag
atcgtgtaccgcttctacaacgtgtga

DBGET integrated database retrieval system