KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_187285Help
Entry
CHLREDRAFT_187285 CDS       T01039                                 

Gene name
DLA3
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cre01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cre00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cre00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cre00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 643 aa AA seqDB search
MQLPGVLLCVVGSLGRGVFGQRLHYAFACSAKSQLQRHEAAAQSCGVLSRCFSGVPAHTI
VGMPALSPTMSQGNIAKWHVKPGQEVSPGSVLADIETDKATLAFENQDEGFVAKLLVPDG
ARDIPIGQPVLVLVEDASSVAAFANFTPGQSAPADAAPAAPVEQPPAAIAAPALMEHAYP
PHTRLTMPSLSPTMDRGNIVAWKVSPGTAIKAGDVLADIETDKATLAYEAVAEEGYVAAL
LVPEGTRDVAVGTPLALLVEDPEHLAAFARLTPEQAHALALGPQSGQAAAAAGITPPASQ
GPAEAAPRVVASERLGPAARLLLESSGLKPEDVTPTGPNNIITKADVLAAIAGGVKPGSA
AAAKPAATKPVAAATAPAAATLKAAAPVAAATAAAQPSAGSAGPSGSGGSGGGSYTDTPN
SQIRRIIAARLLDSKRNTPSLYMRADACLDAVADLRASLAARGTKVSVNDCVLRAVALAL
RDVPAANVHWDEAASDVRAFGGVDISVAVATERGLITPIVRAADVKGLLAVSREVRALAL
KAKDNKLKPEEFTGGSFTVSNLGMYGLTHFSAIINPPQAAILAVGGATERVVLVGGQPAV
RSAMSVTLSADGRVYDGELAGAVLAAFRRHMEQPYELLSATSS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcccggggttctactgtgcgtcgtcgggagcttgggcaggggcgtcttcggg
caaaggctgcactatgcctttgcttgcagcgcaaagtcccaattgcagcggcacgaagct
gcagcgcagtcatgtggagttctgtctcggtgcttctcaggcgtgcctgctcacacgatc
gtcggcatgccagcattatcacctactatgtctcaagggaacatcgcgaagtggcacgtg
aagccgggacaggaggtttcgccgggctcggtcctcgcagacattgagacggataaggcc
acgctggcatttgaaaaccaggacgagggctttgttgcaaagcttcttgtgcccgatggt
gcgcgggacattccgatcggacagccggtgctggtgctggtggaggacgccagcagcgtc
gcagcctttgccaacttcacgccggggcagtccgcacccgctgatgctgcccctgctgcc
cccgtggagcagcccccagcagccattgctgcacctgcgctgatggagcatgcctacccg
ccccacacgcggctgacaatgccctccctgtcacccaccatggaccgtggcaatatcgtg
gcgtggaaggtgtccccgggcactgccatcaaggctggtgacgtgcttgcggacattgag
acggacaaggccacgctggcgtacgaggcggtggcggaggagggctacgtggcggcgctg
ctggtgccggagggcactcgtgacgtggcggtgggcacgcccctggcgctgctggtggag
gaccccgagcacctggccgcctttgcgcgcctcacacccgagcaagcgcacgcgctcgcg
ctgggaccgcagtctggccaagcagctgcggccgcggggattacgccgccggcatcgcag
gggcctgcagaggcggcacctcgcgtggtggccagtgaacggctgggtccggctgctcgg
ctgctgctggagtcgtcaggtctgaaacccgaggacgtgacgcccaccggccccaacaac
atcatcaccaaggcggatgtgctggcggccattgccgggggcgtcaagccgggcagcgcc
gcagcggccaagcccgcagccaccaagcctgtggccgcagctacagcccctgcggcagcg
acgttgaaggcagccgcccccgtagccgcggcaacggcggctgctcagccttccgctggc
tcagcagggccgagcggcagcggtggtagcggtggcggcagctacacggacacgcccaac
agccagatccggcgcatcatcgccgcccggctgctggactccaagcgcaacacgcccagc
ttatacatgcgcgcggacgcctgcctggatgcggtggcggacctgcgggcttcgctcgcg
gcacggggcaccaaggtgtcggtgaacgactgtgtgctccgcgcggtggctctggcactg
cgcgatgtgccggcggcaaacgtgcactgggacgaggccgcaagtgacgtgcgcgccttc
ggcggcgttgacatcagtgtggcggtggccacagagcgcggcctcatcacgcctatcgtg
cgggcggcggatgtcaaggggctgctggcggtgagccgcgaggtgcgggcgctggcgctg
aaagccaaggacaacaagctcaagcctgaggagttcacgggcggctcatttacggtgtcc
aacctgggcatgtacggcctgacgcacttcagcgccatcatcaacccgccgcaggctgcc
atcctggcggtgggcggtgccacggagcgggtggtgctggtgggcggccagccggcggtg
cgcagcgccatgagcgtgacgctgtccgccgacgggcgggtatacgatggcgagctggcg
ggcgcggtgctggcggccttcaggcgccacatggagcagccatacgagctgctgagcgcc
accagcagctga

DBGET integrated database retrieval system