KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_187846Help
Entry
CHLREDRAFT_187846 CDS       T01039                                 

Definition
(RefSeq) hypothetical protein
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 249 aa AA seqDB search
MQRRLRPEPIAVPEEKKASYVLTNKGKFVEGDLTISREGLQINSPASTLGAAPRPGSASS
LQPNKRPLPPEEDSASSRGSSGVAKKVRNKRDGRHMVLKVIQFDVSSDTVRKQTHGAVAV
ARGQQRAVGAAFGAGWGRMGGGVSPERIKGDSYSFDSDLWSLGLTLLECALGRFPYPPPG
ETGVNLGFWELLEYIVMEPPPALPADQFSPALCDFVGQCLQKDAAARPSVTALAAHPFLA
MYPDASLAE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaaggctcaggcctgagccaatagccgtgcccgaggagaagaaggcgagctat
gtcctcaccaacaagggcaagttcgtggagggcgaccttacaattagcagggaaggcctg
cagatcaactcgccagcgagtacgcttggcgcagccccgcggccaggctcagcgagttct
ctccaacccaacaagcggccgctgccgcccgaagaggactcggccagctcgcggggcagc
agcggcgtggccaagaaggtgcgcaacaagcgggacgggcggcacatggtgctcaaggtg
atccagttcgacgtgtcgtcagacaccgtgcgcaagcagacccacggcgccgtggcagtc
gcgcgtggccagcagcgtgccgtcggggctgcgtttggcgcgggatgggggaggatgggg
gggggagtgagtccggagcgcatcaagggcgacagctactcgtttgacagcgacctgtgg
agcctgggcctcacactgctggagtgcgcgctgggcaggttcccctacccgccgccgggc
gagacgggcgtgaacctgggcttctgggagctgctggagtacattgtgatggagccgccg
cccgcgctgcccgccgaccagttcagcccggcgctgtgcgacttcgtgggccagtgcctg
cagaaggacgccgccgcgcgcccctccgtcacggcgctggcggcgcaccccttcctggcc
atgtacccggacgcctcgctggcggag

DBGET integrated database retrieval system