KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_187846Help
Entry
CHLREDRAFT_187846 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CHLREDRAFT_187846
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CHLREDRAFT_187846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 249 aa AA seqDB search
MQRRLRPEPIAVPEEKKASYVLTNKGKFVEGDLTISREGLQINSPASTLGAAPRPGSASS
LQPNKRPLPPEEDSASSRGSSGVAKKVRNKRDGRHMVLKVIQFDVSSDTVRKQTHGAVAV
ARGQQRAVGAAFGAGWGRMGGGVSPERIKGDSYSFDSDLWSLGLTLLECALGRFPYPPPG
ETGVNLGFWELLEYIVMEPPPALPADQFSPALCDFVGQCLQKDAAARPSVTALAAHPFLA
MYPDASLAE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaaggctcaggcctgagccaatagccgtgcccgaggagaagaaggcgagctat
gtcctcaccaacaagggcaagttcgtggagggcgaccttacaattagcagggaaggcctg
cagatcaactcgccagcgagtacgcttggcgcagccccgcggccaggctcagcgagttct
ctccaacccaacaagcggccgctgccgcccgaagaggactcggccagctcgcggggcagc
agcggcgtggccaagaaggtgcgcaacaagcgggacgggcggcacatggtgctcaaggtg
atccagttcgacgtgtcgtcagacaccgtgcgcaagcagacccacggcgccgtggcagtc
gcgcgtggccagcagcgtgccgtcggggctgcgtttggcgcgggatgggggaggatgggg
gggggagtgagtccggagcgcatcaagggcgacagctactcgtttgacagcgacctgtgg
agcctgggcctcacactgctggagtgcgcgctgggcaggttcccctacccgccgccgggc
gagacgggcgtgaacctgggcttctgggagctgctggagtacattgtgatggagccgccg
cccgcgctgcccgccgaccagttcagcccggcgctgtgcgacttcgtgggccagtgcctg
cagaaggacgccgccgcgcgcccctccgtcacggcgctggcggcgcaccccttcctggcc
atgtacccggacgcctcgctggcggag

DBGET integrated database retrieval system