KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_189940Help
Entry
CHLREDRAFT_189940 CDS       T01039                                 

Gene name
PDI2
Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CHLREDRAFT_189940 (PDI2)
Enzymes [BR:cre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CHLREDRAFT_189940 (PDI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 254 aa AA seqDB search
MRSLLVVALVGALALTAHAAGGGGDDPTIKLENVHDLTPDNFDKIVNGAKHVLIEFYAPW
CGHCKRMVPEYKKLGELVAADPKLKNRVVVAKVNADAHRSLGDKFDVRGFPTIKFFPAGK
PATKDNMQDYNQARTASAFLDFLKEKLAADKGFARVEALDALAKKFVDAAADAKAKVVEE
AEAALAKLEGEAKDNGALYVTFMKKAVEKGSEYLTKEKARLEKLLAGGSVNAAKVDEMSR
KTSVLGAFAAEDEE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccctcctcgttgtcgccctggtgggcgccctcgcgctcactgctcacgcggcg
ggtggcggtggtgatgacccgaccatcaagctcgagaatgtgcacgacctgacccccgac
aactttgacaagattgtgaacggcgccaagcacgtgctgattgagttctacgccccttgg
tgcggccactgcaagcgcatggtgcccgagtacaagaagctgggcgagctggtggcagcg
gaccccaagctcaagaaccgcgtggtggtggccaaggtgaacgccgacgctcaccgctcc
ctgggtgacaagttcgatgtgcgcggcttccctaccatcaagttcttccccgctggcaag
cccgccaccaaggacaacatgcaggactacaaccaggcccgcaccgcctccgccttcctg
gacttcctcaaggagaagctggccgcggacaagggctttgcccgcgtggaggccctggac
gcgctggccaagaagttcgtggacgccgccgccgacgccaaggccaaggtggtggaggag
gcggaggcggccctggccaagctggagggcgaggccaaggacaacggcgcgctgtacgtc
accttcatgaagaaggcggtggagaagggctccgagtacctgaccaaggagaaggcccgc
ctggagaagctgctggcgggcggctccgtcaacgccgccaaggtggacgagatgagccgc
aagaccagcgtgctgggcgccttcgcagccgaggacgaggagtaa

DBGET integrated database retrieval system