KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_190447Help
Entry
CHLREDRAFT_190447 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CHLREDRAFT_190447
Peptidases [BR:cre01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CHLREDRAFT_190447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 220 aa AA seqDB search
MAGEKKWIPLESNPDVLNEFISKLGIDAAKYSFSDVFGLDEELLAMVPQPVVAVVMCYPI
TDESDALAKTEDEEQVAKGVAVDPQVFYMKQTIGNACGTIAVLHSIGNNLEQLSPAAGSF
CAQFFGATGGMSPAEVGRYLEHPPAGAPDIEEAHQAAAAGGDTAPPGADEEVNLHFVALV
HRNGQLWELDGRRGAPVCRGPSSPDTLLADAAKVVKDFVS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgaaaagaaatggattccgctcgagtccaacccagacgtgctgaatgagttc
atttccaagcttggaattgatgccgctaaatactcgttctcggacgtgtttggcctggat
gaggagctgctggctatggtgccccagcccgtcgtcgcggtggtgatgtgctatcccatt
acggacgagtcggacgcactagccaagacggaggacgaggagcaggtggccaagggggtg
gcggtggacccccaggtattctacatgaagcaaaccatcggcaacgcctgcggcaccatt
gcggtgttgcactccatcggcaacaacctggagcagctgagcccggctgccggcagcttc
tgcgcccagttcttcggcgccacgggcggcatgagcccggccgaggtggggcgctacctg
gagcacccgccggcgggggcgcccgacatcgaggaggcccaccaggctgcggcggcgggc
ggtgacacggcgccgccgggcgcggatgaggaggtgaacctgcactttgtggcgctggtg
caccgcaacggtcagctgtgggagctggacggccggagaggcgcgcctgtgtgccgcggc
ccctctagtccggacacgttgctggctgatgcagccaaggtggtcaaggacttcgtcagc

DBGET integrated database retrieval system