KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_191043Help
Entry
CHLREDRAFT_191043 CDS       T01039                                 

Gene name
PPX1
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cre00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 563 aa AA seqDB search
MMLTQTPGTATASSRRSQIRSAAHVSAKVAPRPTPFSVASPATAASPATAAARRTLHRTA
AAATGAPTASGAGVAKTLDNVYDVIVVGGGLSGLVTGQALAAQHKIQNFLVTEARERVGG
NITSMSGDGYVWEEGPNSFQPNDSMLQIAVDSGCEKDLVFGDPTAPRFVWWEGKLRPVPS
GLDAFTFDLMSIPGKIRAGLGAIGLINGAMPSFEESVEQFIRRNLGDEVFFRLIEPFCSG
VYAGDPSKLSMKAAFNRIWILEKNGGSLVGGAIKLFQERQSNPAPPRDPRLPPKPKGQTV
GSFRKGLKMLPDAIERNIPDKIRVNWKLVSLGREADGRYGLVYDTPEGRVKVFARAVALT
APSYVVADLVKEQAPAAAEALGSFDYPPVGAVTLSYPLSAVREERKASDGSVPGFGQLHP
RTQGITTLGTIYSSSLFPGRAPEGHMLLLNYIGGTTNRGIVNQTTEQLVEQVDKDLRNMV
IKPDAPKPRVVGVRVWPRAIPQFNLGHLEQLDKARKALDAAGLQGVHLGGNYVSGVALGK
VVEHGYESAANLAKSVSKAAVKA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgacccagactcctgggaccgccacggcttctagccggcggtcgcagatccgc
tcggctgcgcacgtctccgccaaggtcgcgcctcggcccacgccattctcggtcgcgagc
cccgcgaccgctgcgagccccgcgaccgcggcggcccgccgcacactccaccgcactgct
gcggcggccactggtgctcccacggcgtccggagccggcgtcgccaagacgctcgacaat
gtgtatgacgtgatcgtggtcggtggaggtctctcgggcctggtgaccggccaggccctg
gcggctcagcacaaaattcagaacttccttgttacggaggctcgcgagcgcgtcggcggc
aacattacgtccatgtcgggcgatggctacgtgtgggaggagggcccgaacagcttccag
cccaacgatagcatgctgcagattgcggtggactctggctgcgagaaggaccttgtgttc
ggtgaccccacggctccccgcttcgtgtggtgggagggcaagctgcgccccgtgccctcg
ggcctggacgccttcaccttcgacctcatgtccatccccggcaagatccgcgccgggctg
ggcgccatcggcctcatcaacggagccatgccctccttcgaggagagtgtggagcagttc
atccgccgcaacctgggcgatgaggtgttcttccgcctgatcgagcccttctgctccggc
gtgtacgcgggcgacccctccaagctgtccatgaaggcggccttcaacaggatctggatt
ctggagaagaacggcggcagcctggtgggaggtgccatcaagctgttccaggaacgccag
tccaacccggccccgccgcgggacccgcgcctgccgcccaagcccaagggccagacggtg
ggctcgttccgcaagggcctgaagatgctgccggacgccattgagcgcaacatccccgac
aagatccgcgtgaactggaagctggtgtctctgggccgcgaggcggacgggcggtacggg
ctggtgtacgacacgcccgagggccgtgtcaaggtgtttgcccgcgccgtggctctgacc
gcgcccagctacgtggtggcggacctggtcaaggagcaggcgcccgccgccgccgaggcc
ctgggctccttcgactacccgccggtgggcgccgtgacgctgtcgtacccgctgagcgcc
gtgcgggaggagcgcaaggcctcggacgggtccgtgccgggcttcggtcagctgcacccg
cgcacgcagggcatcaccactctgggcaccatctacagctccagcctgttccccggccgc
gcgcccgagggccacatgctgctgctcaactacatcggcggcaccaccaaccgcggcatc
gtcaaccagaccaccgagcagctggtggagcaggtggacaaggacctgcgcaacatggtc
atcaagcccgacgcgcccaagccccgtgtggtgggcgtgcgcgtgtggccgcgcgccatc
ccgcagttcaacctgggccacctggagcagctggacaaggcgcgcaaggcgctggacgcg
gcggggctgcagggcgtgcacctggggggcaactacgtcagcggtgtggccctgggcaag
gtggtggagcacggctacgagtccgcagccaacctggccaagagcgtgtccaaggccgca
gtcaaggcctaa

DBGET integrated database retrieval system