KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_192416Help
Entry
CHLREDRAFT_192416 CDS       T01039                                 

Definition
(RefSeq) hypothetical protein
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CHLREDRAFT_192416
    1.3.1.94  polyprenol reductase
     CHLREDRAFT_192416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 367 aa AA seqDB search
MMTVQEFIAAIADSLLPRLPALLQAYWVLASSAVLLTLLPLPIVPSAFKAAVKLAASRGK
LWHDRPDAKALGFLKDVSVPQQYFEHFYLVGSLVTTVLLQVYIFVCTPDTDGSTLKRDSL
LALFLFELHVLRRYGESNYVMHYPETARMHLLAYLFGLSYYVVAPLTLLPAFVMDVGVLR
GAWDQALGGGKDLAGVDERLYAAVLAPHPGKYRLAGALALYVFASILQFVSHLSLARMSR
EASQRATEFAVVDAINKGNRAGVVGAIPTPAGVVDADGKPLTAKVVHLYEVPRGGVFNLV
SCPHYLAEILIYAALALVTSGSTGSLLMAGWVFLNLVLAAAATQRFYRTRYPNDYPKSRA
ALIPFIL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtccaagagttcatcgcggcgattgctgactcgctgttgccccggctgcca
gcgctcctccaagcatactgggtcctcgcatcatcagcagtgcttcttacacttctgcca
ctgcctatcgtaccaagcgcgtttaaggctgctgtgaagcttgcggcctcgcgaggcaag
ctttggcatgaccggccagatgcaaaggccctgggtttcctaaaggacgtgtccgtgccg
cagcagtactttgagcacttctacctggtgggctcgctggtcaccacggtgctgctgcag
gtctacatcttcgtgtgcacgcccgacacggacggcagcacgctcaagcgcgactccctg
ctggccctgttcctgttcgagctgcacgtgctgcgccgctacggcgagtccaactacgtc
atgcactaccccgagaccgcccgcatgcacctgctggcctacctgttcgggctgtcgtac
tacgtggtggcgccgctcacactgctgcccgccttcgtcatggacgtgggagtgctgcgg
ggcgcctgggaccaggccctgggcgggggcaaggacctggctggtgtggacgagcggctg
tacgcggccgtcctggcgccgcacccgggcaagtaccgcctggcaggggccctggcgctg
tacgtgttcgcctccatcctgcagttcgtgtcgcacctcagcctggcgcgaatgtcgcgg
gaggcctcccagcgcgccaccgagttcgcggtggtggacgcgatcaacaagggcaaccgc
gccggcgtagtgggcgccatccccactcccgcaggcgttgttgacgcggacggcaagccg
ctcacagccaaggtggtgcacctatacgaagtgccgcggggcggcgtgttcaacctggtg
agctgcccgcactacctggctgagatcctcatctacgcggcactggcgctggtgacgagc
ggcagcaccggcagcctgctaatggcgggatgggtgttcctgaacctggtcctggcggct
gccgccacgcagcgcttctaccgcacccgctaccccaatgactaccccaagagccgggcg
gcgctcatccccttcatcctctga

DBGET integrated database retrieval system