KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_192430Help
Entry
CHLREDRAFT_192430 CDS       T01039                                 

Gene name
SSA16
Definition
(RefSeq) predicted protein
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     CHLREDRAFT_192430 (SSA16)
Protein kinases [BR:cre01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   CHLREDRAFT_192430 (SSA16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase
Motif
Other DBs
NCBI-GeneID: 5722703
NCBI-ProteinID: XP_001697122
JGI: 192430
UniProt: A8J6G3
Position
Unknown
AA seq 168 aa AA seqDB search
MERAVRQRYNAMNGTWVTDEVLVKMEGKPFAAGAMRECFAAKKLSTFTHNVDWHKAQNMV
AKRYKKEGVRKSVYYNDVLVQMDAKMLGECYNRTDPPKQVDVMQCAILHFAGRPGGPLYA
VEQLIEGDYVKYNSNSGFVKGDDVLRNTPQALHVGAHPRPEDLCGHPR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcggtgcggcagcgctacaacgccatgaacggcacgtgggtcacggacgag
gtgcttgtgaagatggagggcaagcccttcgccgcgggcgccatgcgtgagtgcttcgcc
gcaaagaagctgagcaccttcacacacaacgtggactggcacaaggcgcagaacatggtg
gccaagcgctacaagaaggagggcgtgcgcaagagcgtctactacaacgacgtgctcgtg
cagatggacgccaaaatgctgggcgagtgctacaaccgcaccgacccgcccaagcaggtg
gacgtcatgcagtgcgccatcctgcacttcgccggccggcccggcgggccgctgtacgcg
gtggagcagctgatcgagggcgactacgtcaagtacaacagcaacagcggcttcgtcaag
ggggacgacgtgctgaggaacacgccgcaggcacttcacgtgggtgctcacccgcggcct
gaagatctgtgtggacatccaagg

DBGET integrated database retrieval system