KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_192806Help
Entry
CHLREDRAFT_192806 CDS       T01039                                 

Gene name
CCPR1
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CHLREDRAFT_192806 (CCPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 376 aa AA seqDB search
MASSAPRLVRLGALLARQGAPATSLLSAQGQAVRAFSEKAAAEAPAAAAAAASKDEAKSK
IRGFQALLFGGLGAGFLYGYSLFTSKVPESGPLAGPPALVTSKPSTPGDYAAVRQSIAAL
LDDGDYDDGSYGPVLVRLAWHASGTYAKKDGSGGSNGATMRFAPECEWGANAGLAVARKL
LEPVKAAHPWISYADLWTLAGVVAIEEMGGPTIPWRAGRSDAPDGSKIVPDGRLPDAKQA
REGGAKHLREVFGRMGFDDKDIVALSGAHTLGRCHTDRSGFSGPWTNAPTTFSNLYFQEL
LNNKWVVKKWDGPLQYEDTKSQSLMMLPSDLALLSDRSFKKYVTQYAKDEEAFFKDFAVA
FSKLLELGVPFPAKSA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctctgctcctcgcctggtccgcctgggtgcgctactggctcgccagggagcg
cccgcgacgtcgctgctctcggctcagggccaggccgtgcgcgctttctccgagaaggca
gcagccgaggcacctgctgccgcggccgccgcggcgtcgaaggatgaggccaagagcaag
attcggggcttccaggctctgctgttcggcggcctgggcgcgggcttcctgtacggctac
tcactgttcaccagcaaggtgccggagagcgggccgctggcagggccgcccgcgctggtg
accagcaagccctccacgcccggcgactacgcggctgtgcggcagtccattgcggccctg
ctggacgacggcgactacgacgacggcagctacggccccgtgctggtgcggctggcctgg
cacgcctccggcacctacgccaagaaggacggcagcggcggcagcaacggggccaccatg
cgctttgctcccgagtgcgagtggggcgccaacgcgggtctggcggtggctcgcaagctg
ctggagcccgtcaaggccgcgcacccctggatcagctacgccgacctgtggacgctggcg
ggcgtggtggccatcgaggagatgggcggccccaccatcccctggcgcgccggccgctcc
gacgcgcccgacggctccaagatcgtgccggacggccgcctgccggacgccaaacaggcg
agagagggtggcgccaagcacctgcgcgaggtgtttggccgcatgggctttgacgacaag
gacattgtggcgctcagcggcgcacacacgctgggccgctgccacacagaccgcagcggc
ttcagcggcccctggaccaacgcgccgaccaccttctccaacctgtacttccaggagctg
ctcaacaacaagtgggttgtcaagaagtgggacgggccgctgcagtacgaggacaccaag
agccagagcctgatgatgctgccctctgacctggcgctgctcagcgaccgcagcttcaag
aagtacgtgacccagtacgccaaggatgaggaggcgttcttcaaggactttgcggtggcg
ttctctaagctgctggagctgggcgtgcccttccccgccaagagcgcgtga

DBGET integrated database retrieval system