KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_193901Help
Entry
CHLREDRAFT_193901 CDS       T01039                                 

Gene name
MAPK8
Definition
mitogen-activated protein kinase 8 (EC:2.7.1.-)
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:cre00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    CHLREDRAFT_193901 (MAPK8)
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CHLREDRAFT_193901 (MAPK8)
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CHLREDRAFT_193901 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 389 aa AA seqDB search
MADPGAQPVPAPQSAEEPVTGGLQESVEVTASGKLDSYNREYNQFLVCGSLFECPAKYLP
IKPIGKGAYGVVCSAKNLDNQEKVAIKKIANAFDNVIDAKRTLREIKLLRHLQHENIVQI
KDIIPPTNRDAFKDLYVVYELMDTDLHQIIRSPQALSNDHSQYFLYQLLRGLKYIHSANI
LHRDLKPSNLLVNANCDLKICDFGLARTSTSNEKEFMTEYVVTRWYRAPELLLSCSGYTT
AIDVWSVGCIFAELLGRKPLFPGKDYVHQLSLITKVIGSPSEEELGFITSEKAKRYIRSL
PRSERVDFGQLWPHVTKTALDLIDKMLVFDPTKRITVEQALEHPYLASLHDVSDEPVCPT
PFTFDFDSEHLTPDVVREVILQDMAELHT
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctggggcccaacctgtcccagctccccagtctgcggaagagccggtcacc
ggaggccttcaagagtccgtggaagtcacagcgtcagggaaattagactcatacaaccgc
gagtacaaccaattcctggtttgcggcagcctctttgagtgccccgctaagtacctgccc
atcaagcccatcggcaagggggcgtatggcgtcgtctgctccgccaagaacctggacaac
caggagaaggtggccatcaagaagatcgcaaacgcctttgacaacgtcatcgacgccaaa
cgcaccctgcgcgagatcaagttgttgcgccacctgcagcacgagaacattgtgcagatc
aaagacatcatcccgcccaccaaccgcgatgccttcaaggacctctacgtggtgtatgag
ctgatggacaccgacctgcaccagatcatccgctcgccacaggcgctgtccaacgaccac
agccagtacttcctgtaccagctgttgagagggctcaaatacatccacagcgccaacatc
ctgcacagagatttgaagcccagcaacctgctcgtgaacgccaactgcgacctcaaaatc
tgcgacttcggccttgcacggaccagcaccagcaacgagaaggagttcatgacggagtac
gtggtgacgcgctggtaccgcgcccccgagctgctgctgagctgcagcggctacaccact
gccatcgacgtgtggtccgtgggctgcatcttcgcggagctgctgggccgcaagccgctg
ttccccggcaaggactacgtgcaccagctgtccctcatcaccaaggtgatcggctccccc
agcgaggaggagcttggcttcatcaccagcgagaaggccaagcgctacatccgctcgctg
ccgcgatccgagcgagtggacttcgggcagctgtggccgcacgtcaccaagacggcgctg
gacctgattgacaagatgctggtgttcgaccccaccaagcgcatcaccgtggagcaggcg
ctggagcacccctacctggcctcgctgcacgacgtgtccgacgagcccgtgtgccccaca
cccttcaccttcgacttcgacagcgagcacctcacgccggacgtggtgcgggaggtcata
ctgcaggacatggccgagctgcacacctga

DBGET integrated database retrieval system