KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195415Help
Entry
CHLREDRAFT_195415 CDS       T01039                                 

Gene name
CHC1
Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
cre  Chlamydomonas reinhardtii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CHLREDRAFT_195415 (CHC1)
Exosome [BR:cre04147]
 Exosomal proteins
  Proteins found in most exosomes
   CHLREDRAFT_195415 (CHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1738 aa AA seqDB search
MAAPLLVSEKLLLPSIGVAQDFISFKNVSMESEKYICVRETGAQNTVVIVDMSNPLNPAR
RQISADSALMCLDKKVIALKAVTAGTAGDTLQVFNLDTKTKLKAYQMPETVEFWKWITPT
MLGLVTAGAVYHWDVEGASDAPTKVFDRTPNLAGSQIISYRTSTDNKWAVLIGIAPGAPE
RPQLAKGLMQLYSFEQAKSQPLEAHAAAFANVKFTGRDTPSLVISFAQKTLKDGQIISKL
HVIELGGAAAGGAIKRSAELFFPADFADDFPVSLQISEKFGLVYVVSKLGFVFVYDLESA
TAVYRNRISPDPVFLACPSDSTGGIYAINRRGQVLLATVNEATMVPFVSQQLNNLDLAMA
MAKRGNLPGAEALVGQQFERLFAAGQYKEAAECAAESPQGQLRTRDVMDKLKGVVPPAGQ
KPPILVYLGVLLQRGKLNAAESAELARLVLSQNKKDLLVNWWGEGKLEACEELGDAISAA
GDKDFALKVYQQCGAGPKVIATLAEKGDIQALIAYTGQSGQKLDYMFLLQSLMMNNPNGA
VALAKMVAKQTPPPVDVNVMADLFLQVCVCVCGRDAGGDNSGDGIGVVVNNGRRNMIREA
TAFLLDALSGDKPEQAALQSKLLEINLVTNPQVADAILAGGTLTHYDRPRIAQLCEKAGL
YMRALQHYTDLSDIKRCIINTHAIDPQALVEYFGTLSSDWALDCLKELLVSNMAQNLQLV
VNIAKEYTEQLTASKVIELFEAYNSYHGLYFYLGARISFTEDPEEHFKYIEAAARTGNLK
EVERVTRESSHYPPDKVKAFLMEAKLPDARPLINVCDRFDMVEDLTQYLFANNMLRYIEG
YVQKVSPAKAPAVVGALLDCEAPDEFINNLILSVRSLLPVDKLVEAVERRNRLKLLTPFL
EHLISEGSQDPHVHNALGKIIIDTNNNPEHFLTTNPYYDSLVVGKHAEKRDPNLAVIAYK
RGTCDDALIECTSKNALFKPQARYIVERADPALWAKVLDEANEHRASLIEQVVGTALPES
RNPEQVSVTVKSFMAQGLQSELIELLEKIVLQNSAFSNNANLQNLLILTAIKSDKTRVKG
YIYRLDNFDGPAVAEKAIEHGLAEEAFEIFKKFNKRVEAVKVLLEQLKDLPRASEWASKC
DEPAVWSELGHAQLAAGQVAEAIASYLKAGDSSRYVQVTETAKGSGCYDDLVKYLLMVRK
KVKEPKVDTELVYAYAKTSNMAALEEFISATHQANLQACGDRCYEEGLYEAARVLFAHLP
NYGRLASTLVRLRQFQQAVDAARKANSPKTWKEVCYACVDEKEFRLAQLCGLAIIVNADE
LDEVSETYQRKGHFDELIALMESGIGLERAHMGIFTELGILYARYRPEKLMEHLKLFGNR
LNIPRLIRVCDEQQHWKELTLLYIAYDEYDNAALCMINHSPVAWEHVQFKDVAVKVSSTE
THYRGLAFYLDEHPDLLCDLLGVLQSRLDHGRVVDMMRRANQLPLIKDYLLGVQKANHTE
VNEAINSLLIEEEDFEGLKHSISTYDNFDQLGLAARLEKHELIEFRRLAAMVYKQNQKWR
RAVELAQADGLFRDAMETTAQSGEAELAEELLRYFIEKGEKECFAACLYTCYDLLRPDVV
LELSWMNGLTDYSMPYMIQMLKEYVGKVDMLMSERKEQQKEKEQAQQAQRHQEAQRNAYA
TLMPLALPAPNMTGPGGPGGGYGDHHGAAGAGGFGAAPHGGFGGAPQGFGGHPFGGQY
NT seq 5217 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccgttgttggtgtccgagaagctgctgctccccagtattggggttgcgcag
gacttcatctcgttcaagaatgtctctatggagtcagagaagtacatttgcgtccgcgag
accggtgctcagaacaccgtggtcatcgtggacatgtccaacccgctgaatcctgcgcgg
aggcagatcagcgcggacagtgccctcatgtgccttgacaagaaggtcatcgcgctgaag
gccgtgaccgcgggcactgcaggcgacaccctgcaggtgtttaaccttgacaccaaaacg
aagctgaaggcataccagatgccggagacggtggagttttggaagtggatcactccgacg
atgcttggcctcgtgaccgcgggcgcagtctaccactgggacgtggagggcgcgtcggat
gctcccaccaaggtgttcgaccggaccccgaacttggcgggctcccagattatcagctac
cgcactagcacggacaacaagtgggcggtcctcatcggcattgcccctggcgcgccggag
cggccgcagctggcgaagggcctcatgcagctgtactccttcgagcaggccaagagccag
ccgctggaggcgcatgccgcggccttcgcgaatgtcaagttcacgggccgggacacaccc
agcctggtcatctcgttcgcccagaagaccctgaaggacgggcagatcatctccaagctg
cacgtcattgagctgggcggcgcggcggctggcggcgccatcaagcgcagcgcggagctg
ttcttcccggcggactttgcggacgacttcccggtctcgctgcagatcagcgagaagttc
gggctggtgtacgtggtgtccaagctgggcttcgtgttcgtgtacgacctggagtccgcc
accgccgtgtaccgcaaccgcatcagcccggaccccgtgttcctggcctgccccagcgac
agcaccggcggcatctacgctatcaaccggcgcggccaggtgctgcttgcgaccgtgaac
gaggcgaccatggtgccgttcgtgagccagcagctcaacaacctggacctcgccatggcc
atggccaagcgcggcaacctgccgggcgcggaggcgctggtgggccagcagtttgagcgc
ctgttcgcggcgggccagtacaaggaggcggcggagtgcgccgcggagtcgccgcagggc
cagctccgcacgcgcgatgtgatggacaagctgaagggcgtggtgccgcccgccggccag
aagccgcccatcctggtgtacctgggcgtgctgctgcagcgcggcaagctcaacgccgcg
gagtcggcggagctggcgcgtctggtgctgagccagaacaagaaggacctgctggtcaac
tggtggggcgagggcaagctggaggcgtgcgaggagctgggtgacgccatcagcgcggcg
ggcgacaaggacttcgcgctcaaggtgtaccagcagtgcggcgccggccccaaggtcatc
gccacgctggcggagaagggcgacatccaggcgctgatcgcctacacgggccagagcggc
cagaagcttgactacatgttcctgctgcagagcctcatgatgaacaaccccaacggcgcc
gtggcgctggccaagatggtggccaagcagacgccgccgccggtggacgtcaacgtcatg
gctgacctgttcctgcaggtgtgtgtatgtgtgtgcggccgtgatgccggcggtgacaat
agcggtgatggtattggcgtggtggtgaataatggacggcgcaacatgatccgcgaggcg
accgccttcctgctggacgcgctgtcgggcgacaagccggagcaggcggcgctgcagagc
aagctgctggagatcaacctggtcaccaacccgcaggtcgcggacgccatcctggccggc
ggcacgctgacgcactacgaccggccgcgcatcgcgcagctgtgcgagaaggccggcctg
tatatgcgcgcgctgcagcactacaccgacctgtcggacatcaagcgctgcatcatcaac
acgcacgcgatcgacccccaggcgctggtggagtactttggcacgctgtccagcgactgg
gcgctggactgcctgaaggagctgctggtgagcaacatggcgcagaacctgcagctggtg
gtcaacatcgccaaggagtacacggagcagctgacggcctccaaggtcattgagctgttc
gaggcctacaactcgtaccacggcctgtacttctacctgggcgcgcgcatctcgttcacc
gaggaccccgaggagcacttcaagtacatcgaggcggctgctcgcaccggcaacctgaag
gaggtggagcgcgtcacccgcgagtcgtcgcactacccgcccgacaaggtcaaggccttc
ctgatggaggccaagctgccggacgcccgcccgctcatcaacgtgtgcgaccgcttcgac
atggtggaggacctgacgcagtacctgttcgccaacaacatgctgcgctacatcgagggc
tacgtgcagaaggtgtcgccggccaaggcgcccgccgtggtgggcgcgctgctggactgc
gaggcgcccgacgagttcatcaacaacctcatcctgtcggtgcgctcgctgctgccggtg
gacaagctggtggaggcggtggagcgccgcaaccgcctcaagctgctgacgcccttcctg
gagcacctcatcagcgagggcagccaggacccgcacgtgcacaacgcgctgggcaagatc
atcatcgacaccaacaacaacccggagcacttcctaaccactaacccctactacgactcg
ctcgtggtcggcaagcacgcggagaagcgcgaccccaacctggccgtcattgcctacaag
cgcggcacctgcgacgacgcgctcatcgagtgcacgtccaagaacgcgctgttcaagccg
caggcccggtacattgtggagcgtgctgaccccgcgctgtgggccaaggtgctggacgag
gccaacgagcaccgcgcctcgctcattgagcaggtggtgggcaccgccctgcccgagagc
cgcaaccccgagcaggtcagcgtcacagtcaagtcgttcatggcccagggcctgcagtcg
gagctgatcgagctgctggagaagattgtgctgcagaacagcgccttctccaacaacgcc
aacctgcagaacctgctcatcctcaccgccatcaagtccgacaagacccgcgtcaagggc
tacatctaccgcctggacaactttgacgggcccgccgtggccgagaaggccatcgagcac
ggcctggcggaggaggcgtttgagatcttcaagaagttcaacaagcgcgtggaggccgtc
aaggttctgctggagcagctgaaggacctgccgcgcgcctcggagtgggcctccaagtgc
gacgagccggcggtttggagcgagctgggccacgcgcagctggcggcgggccaggtggcg
gaggccatcgcctcctacctcaaggccggcgactcgagccgctacgtgcaggtgacggag
acggccaagggtagcggctgctacgacgacctggtcaagtacctgctgatggtgcgcaag
aaggtcaaggagcctaaggtggacacggagctggtgtacgcgtacgccaagacctccaac
atggcggcgctggaggagttcatctccgccacgcaccaggccaacctgcaggcctgcgga
gaccgctgctacgaggaggggctgtacgaggcggcgcgcgtgctgttcgcgcacctgccc
aactacggccgcctggcttccacgctggtgcggctgcggcagttccagcaggcggtggac
gcggcgcgcaaggccaacagccccaagacctggaaggaggtttgctacgcgtgcgtggac
gagaaggagttccgcctggcgcagctgtgcggcctggccatcatcgtcaacgccgacgag
ctggacgaggtgtcggagacctaccagcgcaagggccactttgacgagctgattgcgctg
atggagagcggcatcggcctggagcgggcgcacatgggcatcttcaccgagctgggcatc
ctgtacgcccgctaccggcccgagaagctgatggagcacctgaagctgttcggcaaccgg
ctcaacatcccgcgcctcatccgcgtgtgcgacgagcagcagcactggaaggagctcacg
ctgctgtacatcgcctacgacgagtacgacaacgccgcgctgtgcatgatcaaccactcg
cccgtggcgtgggagcacgtgcagttcaaggacgtggcggtcaaggtgtccagcaccgag
acgcactaccgcggcctggccttctacctggacgagcacccggacctgttgtgcgacttg
ctgggcgtgctgcagagccgtctggaccacggccgcgtggtggacatgatgcgccgcgcc
aaccagctgccgctcatcaaggactacctgctgggcgtgcagaaggccaaccacaccgag
gtcaacgaggccatcaactcgctgctgatcgaggaggaggacttcgagggcctcaagcac
tccatctccacctacgacaacttcgaccagctgggcctggctgctcggctggagaagcac
gagctcattgagttccggcggctggcggcgatggtgtacaagcagaaccagaagtggcgg
cgcgcggtggagctggcacaggcggacgggctgttccgggacgcgatggagaccacggcg
cagagtggggaggcggagcttgcggaggagctgctgcggtattttatcgagaagggcgag
aaggagtgcttcgcggcctgcctgtacacctgctacgacctgctgcggccggacgtggtg
ctggagctgtcctggatgaacggcctcaccgactactccatgccctacatgatccagatg
ctgaaggagtatgtgggcaaggtggacatgctcatgtcagagcgcaaggagcagcagaag
gagaaggagcaggcgcagcaggcgcagcgccaccaagaggcgcagcgcaacgcctacgcc
acactcatgccactggctctgcccgcgcccaacatgactgggccgggcgggccaggcggc
ggctacggcgaccaccacggggctgcgggcgccggcggcttcggggcggcgccccacggc
ggcttcggcggggccccgcaaggtttcggggggcaccctttcggcggtcagtattaa

DBGET integrated database retrieval system