KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195506Help
Entry
CHLREDRAFT_195506 CDS       T01039                                 

Definition
protein with ARF GTPase-activating domain
Orthology
K12489  
Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
cre  Chlamydomonas reinhardtii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cre04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 875 aa AA seqDB search
MGLEDTPPFRLKVAEMEGSCRKLKDKVSKLVAHYRQYRDALVHLCKAQSLFVGGLAEFFS
GEESEQLSGGVPVHKYISTLGESTSYFDLLKIQIEFAADQISAEWLDDLLVGARDSHRAF
ERSSSDLEDATSRVLALKKAGRPGEGRSGARFDVARRLAAADARRRYSFLQLLLDSVGAH
HAALRSGSEMLGRLTPLGDTARAVVAEARTAEGELQAKLVEEAARCKALSAEAAAAAAAA
PSSLDESGHGPMQMTAAKSAAVLAAEAALRNTRAAQTAGDANPSVTVLRQGYLLKRSGGA
GAGGGAGGKVVAGEWKRRFFVLDSRGVLYYYSQKDSLLNKLRGVEAHTPATTGVNLLTST
IKLDDEAEPQLRFCFRVVSPTGTLALQAESEPDRAAWVAISTLLNSVASDGGALPLPGSP
AMRPVPSSSFSAAGASAAAAATGGVAAGLVSAGSNLVSPMGSVTADVRGLSIGGGAAHPH
SAVGTPSRHTASASADSSVGGGNAVSPLELLRRVPGNTACCDCGAPDPDWASLNLGCLLC
IECSGVHRQLGVHVSKVRSLTLDVRVWEPSILELFKQLGNAAVNTVWEARLPAQQQQMQQ
QHQQQLHNQQQESPSTSGRGDDGWVWCEDEEDDANPFNAAALARKAARGNSGGGAGSEGW
MLGKPHLRAPLAEKQRYIQAKYVGRMYVAAVPPQVQTGPGGRAHQLSLLLWHAVEAGDVR
AALQAIAWGADPAAQVRAPRAALLINEMREMAAMAPPHAGYGGGGMALTLTCLHLAAVDG
ALRLVELLLQSGAQADAVDGAGGGHTPLHYALLSDRYDAAKLLLRRGASLGVRDNGGRNA
WDLVVGVKGRLADEELFLLLSSAGASASGTVGGGL
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagaggacactccaccgtttcgcctgaaggtggcggagatggagggcagctgc
aggaagctcaaggacaaggtctccaagctggtggcgcactaccggcagtacagggacgct
ctggtgcatctgtgcaaggcgcagtcgctgtttgtgggcgggctagcggagttcttcagt
ggagaggagagcgagcagctgtcaggtggtgtgcccgtgcataagtatatcagcacgctc
ggcgagtcgacctcctacttcgacttgcttaagatccagattgagttcgccgcggaccag
atctcggccgagtggctggacgacctactggtgggcgcgagggactcacaccgcgccttc
gagcgcagcagctccgacctggaggacgccacctcgcgcgtgctggcgctcaaaaaggca
gggcggcccggcgaggggcgcagcggggcgcgctttgacgtggcacggcggctggctgcg
gcggacgcgcggcggcgctacagcttcctgcagctgctgctcgacagcgtgggtgcacac
cacgccgcgctgcgcagtggcagcgagatgctgggccgcctcacgccgctcggggatacg
gcacgagccgtggtggcagaggcgcgcaccgcggagggagagttacaggccaagctggtg
gaggaggcagcccgttgcaaggcgctcagtgcggaggcggcggctgcggcagcagctgcg
cccagctccctggacgaatcggggcacggacccatgcagatgacggctgccaagtctgcg
gcggtgctcgcggctgaggcggcactgcggaacacgcgcgcggcgcaaacagccggggac
gccaacccgtctgtcaccgttctcagacagggctacctgctcaagcgcagcggcggtgcg
ggcgcgggcggcggcgcgggcggcaaggtggtggcgggcgagtggaagcggcggtttttc
gtgctggactcgcgcggcgtgctgtactactacagccaaaaggactcgctgctcaacaag
ctgcgcggcgtggaggcgcacacgcccgccaccaccggcgtcaacctgctcacctccacc
atcaagctggatgacgaagcggagccgcagctgcgcttctgcttcagggtggtgagcccc
acaggcacactggcactccaagccgagtccgagcccgaccgcgcggcctgggttgccatc
agcacgctgctcaactcggtggcgtcagacggcggcgcgctgccgctgccgggctcgcca
gcgatgcgccctgtccccagctcctccttcagcgccgcaggcgccagtgccgcggcagcg
gcaaccggcggcgtggcggctggtcttgtcagcgcgggctcaaacctggtcagcccgatg
ggcagcgtgaccgccgacgtgcgagggttgtccattggtggcggggcagcgcacccgcac
tcggcggtggggacgccatcgcgccacacggcgtcggcgtcggcggactcgtcagtgggc
ggcggcaacgccgtcagtcccttggaactgctcaggcgtgtgcccggcaacacggcctgc
tgcgactgcggcgctccggaccccgactgggcgtcgctcaacctcgggtgtctgctctgc
attgagtgctcaggcgtgcaccggcaactaggcgtgcacgtgtcaaaggttcgctcactg
actctggatgtgcgcgtgtgggagccgtccattctcgagctgttcaagcagctgggcaac
gcagccgtcaacaccgtgtgggaggcgcgcctgcccgcgcagcagcagcagatgcagcag
cagcaccagcaacagctgcataaccagcaacaggagagcccgtccaccagcggccgcgga
gatgacggctgggtgtggtgcgaggacgaggaggatgacgcaaaccccttcaacgcggcg
gcgctggcgcggaaggccgcccgcggcaacagcggtggcggcgcgggcagcgaaggctgg
atgctgggcaagccacacctccgagcgccgctagcggagaagcaaagatacatccaggcc
aagtacgttgggcggatgtatgtggcggcggtgccgccgcaggtgcagaccggcccgggc
ggccgcgcgcatcagttgtcgctgctgctgtggcacgcggttgaggcgggcgacgtgcgg
gcagcgctgcaggccatcgcgtggggggcagacccggcggcgcaggtccgcgcccctcgc
gcggcgctgttgatcaacgagatgcgcgagatggcggccatggcgccgccgcacgcgggg
tacggcggcggcggcatggctctgactctgacgtgcctgcacctggcggctgtggacggc
gccctgaggctggtggagctgctgctgcagagcggcgcgcaggcagacgcggtggacggc
gcggggggcggccacacgccgctgcactacgcgctcctgtccgaccggtatgacgccgcg
aagctgttgctgcggcgcggcgcctcgctgggcgtgcgcgacaacggcggccgcaacgcc
tgggacttggtggtgggtgtgaaggggcggctcgcggatgaggagttgttcctgctgctc
agcagcgcgggcgccagcgccagcggcaccgtcgggggcgggttgtag

DBGET integrated database retrieval system