KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195524Help
Entry
CHLREDRAFT_195524 CDS       T01039                                 

Gene name
CHLH1
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cre00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1399 aa AA seqDB search
MQTSSLLGRRTAHPAAGATPKPVAPSPRVASTRQVACNVATGPRPPMTTFTGGNKGPAKQ
QVSLDLRDEGAGMFTSTSPEMRRVVPDDVKGRVKVKVVYVVLEAQYQSAISAAVKNINAK
NSKVCFEVVGYLLEELRDQKNLDMLKEDVASANIFIGSLIFIEELAEKIVEAVSPLREKL
DACLIFPSMPAVMKLNKLGTFSMAQLGQSKSVFSEFIKSARKNNDNFEEGLLKLVRTLPK
VLKYLPSDKAQDAKNFVNSLQYWLGGNSDNLENLLLNTVSNYVPALKGVDFSVAEPTAYP
DVGIWHPLASGMYEDLKEYLNWYDTRKDMVFAKDAPVIGLVLQRSHLVTGDEGHYSGVVA
ELESRGAKVIPVFAGGLDFSAPVKKFFYDPLGSGRTFVDTVVSLTGFALVGGPARQDAPK
AIEALKNLNVPYLVSLPLVFQTTEEWLDSELGVHPVQVALQVALPELDGAMEPIVFAGRD
SNTGKSHSLPDRIASLCARAVNWANLRKKRNAEKKLAVTVFSFPPDKGNVGTAAYLNVFG
SIYRVLKNLQREGYDVGALPPSEEDLIQSVLTQKEAKFNSTDLHIAYKMKVDEYQKLCPY
AEALEENWGKPPGTLNTNGQELLVYGRQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHG
FAAYYTFLEKIFKADAVLHFGTHGSLEFMPGKQVGMSGVCYPDSLIGTIPNLYYYAANNP
SEATIAKRRSYANTISYLTPPAENAGLYKGLKELKELISSYQGMRESGRAEQICATIIET
AKLCNLDRDVTLPDADAKDLTMDMRDSVVGQVYRKLMEIESRLLPCGLHVVGCPPTAEEA
VATLVNIAELDRPDNNPPIKGMPGILARAIGRDIESIYSGNNKGVLADVDQLQRITEASR
TCVREFVKDRTGLNGRIGTNWITNLLKFTGFYVDPWVRGLQNGEFASANREELITLFNYL
EFCLTQVVKDNELGALVEALNGQYVEPGPGGDPIRNPNVLPTGKNIHALDPQSIPTQAAL
KSARLVVDRLLDRERDNNGGKYPETIALVLWGTDNIKTYGESLAQVMMMVGVKPVADALG
RVNKLEVIPLEELGRPRVDVVVNCSGVFRDLFVNQMLLLDRAIKLAAEQDEPDEMNFVRK
HAKQQAAELGLQSLRDAATRVFSNSSGSYSSNVNLAVENSSWSDESQLQEMYLKRKSYAF
NSDRPGAGGEMQRDVFETAMKTVDVTFQNLDSSEISLTDVSHYFDSDPTKLVASLRNDGR
TPNAYIADTTTANAQVRTLGETVRLDARTKLLNPKWYEGMLASGYEGVREIQKRMTNTMG
WSATSGMVDNWVYDEANSTFIEDAAMAERLMNTNPNSFRKLVATFLEANGRGYWDAKPEQ
LERLRQLYMDVEDKIEGVE
NT seq 4200 nt NT seq  +upstreamnt  +downstreamnt
atgcagacttcctcgcttcttggccggcgcacggcccacccggctgcgggcgcgacgccc
aagccggttgcgccctcgccccgcgtggctagcacccgccaggtcgcgtgcaatgtggcg
actggaccccggccgcccatgaccaccttcaccggtggcaacaagggccctgctaagcag
caggtgtcgctggatctgcgcgacgagggcgctggcatgttcaccagcaccagcccggag
atgcgccgtgtcgtccctgacgatgtgaagggtcgcgttaaggtgaaggttgtgtacgtg
gtgctggaggcccagtaccagtcggccatcagcgctgcggtgaagaacatcaacgccaag
aactccaaggtgtgcttcgaggtggtgggctacctgctggaggagctgcgtgaccagaag
aacctcgatatgctcaaggaggatgtggcctctgccaacatcttcatcggctcgctcatc
ttcattgaggagcttgccgagaagattgtggaggcggtgagccccctgcgcgagaagctg
gacgcgtgcctgatcttcccgtccatgccggcggtcatgaagctgaacaagctgggcacg
ttttcgatggctcagctgggccagtcgaagtcggtgttctcggagttcatcaagtctgct
cgcaagaacaacgacaacttcgaggagggcttgctgaagctggtgcgcaccctgcctaag
gtgctgaagtatctgccctcggacaaggcgcaggacgccaagaacttcgtgaacagcctg
cagtactggctgggcggtaactcggacaacctggagaacctgctgctgaacaccgtcagc
aactacgtgcccgctctgaagggcgtggacttcagcgtggctgagcccaccgcctacccc
gatgtgggtatctggcaccctctggcctcgggcatgtacgaggacctgaaggagtacctg
aactggtacgacacccgcaaggacatggtcttcgccaaggacgcccccgtcattggcctg
gtgctgcagcgctcgcacctggtgactggcgatgagggccactacagcggcgtggtcgct
gagctggagagccgcggtgctaaggtcatccccgtctttgccggtggcctggacttctcc
gcccccgtcaagaagttcttctacgaccccctgggctctggccgcacgttcgtggacacc
gttgtgtcgctgaccggcttcgcgctggtgggcggccccgcgcgccaggacgcgccgaag
gccattgaggcgctgaagaacctgaacgtgccctacctggtgtcgctgccgctggtgttc
cagaccactgaggagtggctggacagcgagctgggcgtgcaccccgtccaggtggctctg
caggttgccctgcccgagctggatggtgccatggagcccatcgtgttcgctggccgtgac
tcgaacaccggcaagtcgcactcgctgcccgaccgcatcgcttcgctgtgcgctcgcgcc
gtgaactgggccaacctgcgcaagaagcgcaacgccgagaagaagctggccgtcaccgtg
ttcagcttcccccctgacaagggcaacgtcggcactgccgcctacctgaacgtgttcggc
tccatctaccgcgtgctgaagaacctgcagcgcgagggctacgacgtgggcgccctgccg
ccctcggaggaggatctgatccagtcggtgctgacccagaaggaggccaagttcaactcg
accgacctgcacatcgcctacaagatgaaggtggacgagtaccagaagctgtgcccttac
gccgaggcgctggaggagaactggggcaagccccccggcaccctgaacaccaacggccag
gagctgctggtgtacggccgccagtacggcaacgtcttcatcggcgtgcagcccaccttc
ggctacgagggcgacccgatgcgcctgctgttctcgaagtcggccagcccccaccacggc
ttcgccgcctactacaccttcctggagaagatcttcaaggccgacgccgtgctgcacttc
ggcacccacggctcgctggagttcatgcccggcaagcaggtcggcatgtcgggtgtgtgc
taccccgactcgctgatcggcaccatccccaacctctactactacgccgccaacaacccg
tctgaggccaccatcgccaagcgccgctcgtacgccaacaccatttcgtacctgacgccg
cctgccgagaacgccggcctgtacaagggcctgaaggagctgaaggagctgatcagctcg
taccagggcatgcgtgagtctggccgcgccgagcagatctgcgccaccatcattgagacc
gccaagctgtgcaacctggaccgcgacgtgaccctgcccgacgctgacgccaaggacctg
accatggacatgcgcgacagcgttgtgggccaggtgtaccgcaagctgatggagattgag
tcccgcctgctgccctgcggcctgcacgtggtgggctgcccgcccaccgccgaggaggcc
gtggccaccctggtcaacatcgctgagctggaccgcccggacaacaacccccccatcaag
ggcatgcccggcatcctggcccgcgccattggtcgcgacatcgagtcgatttacagcggc
aacaacaagggcgtcctggctgacgttgaccagctgcagcgcatcaccgaggcctcccgc
acctgcgtgcgcgagttcgtgaaggaccgcaccggcctgaacggccgcatcggcaccaac
tggatcaccaacctgctcaagttcaccggcttctacgtggacccctgggtgcgcggcctg
cagaacggcgagttcgccagcgccaaccgcgaggagctgatcaccctgttcaactacctg
gagttctgcctgacccaggtggtcaaggacaacgagctgggcgccctggtagaggcgctg
aacggccagtacgtcgagcccggccccggcggtgaccccatccgcaaccccaacgtgctg
cccaccggcaagaacatccacgccctggaccctcagtcgattcccactcaggccgcgctg
aagagcgcccgcctggtggtggaccgcctgctggaccgcgagcgcgacaacaacggcggc
aagtaccccgagaccatcgcgctggtgctgtggggcactgacaacatcaagacctacggc
gagtcgctggcccaggtcatgatgatggtcggtgtcaagcccgtggccgacgccctgggc
cgcgtgaacaagctggaggtgatccctctggaggagctgggccgcccccgcgtggacgtg
gttgtcaactgctcgggtgtgttccgcgacctgttcgtgaaccagatgctgctgctggac
cgcgccatcaagctggcggccgagcaggacgagcccgatgagatgaacttcgtgcgcaag
cacgccaagcagcaggcggcggagctgggcctgcagagcctgcgcgacgcggccacccgt
gtgttctccaacagctcgggctcctactcgtccaacgtcaacctggcggtggagaacagc
agctggagcgacgagtcgcagctgcaggagatgtacctgaagcgcaagtcgtacgccttc
aactcggaccgccccggcgccggtggcgagatgcagcgcgacgtgttcgagacggccatg
aagaccgtggacgtgaccttccagaacctggactcgtccgagatctcgctgaccgatgtg
tcgcactacttcgactccgaccccaccaagctggtggcgtcgctgcgcaacgacggccgc
acccccaacgcctacatcgccgacaccaccaccgccaacgcgcaggtccgcactctgggt
gagaccgtgcgcctggacgcccgcaccaagctgctcaaccccaagtggtacgagggcatg
cttgcctcgggctacgagggcgtgcgcgagatccagaagcgcatgaccaacaccatgggc
tggtcggccacctcgggcatggtggacaactgggtgtacgacgaggccaactcgaccttc
atcgaggatgcggccatggccgagcgcctgatgaacaccaaccccaacagcttccgcaag
ctggtggccaccttcctggaggccaacggccgcggctactgggacgccaagcccgagcag
ctggagcgcctgcgccagctgtacatggacgtggaggacaagattgagggcgtcgaataa

DBGET integrated database retrieval system