KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195847Help
Entry
CHLREDRAFT_195847 CDS       T01039                                 

Gene name
SRP36
Definition
(RefSeq) SR protein factor
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Corona_nucleoca Nup35_RRM_2 DUF1777 SRP-alpha_N
Motif
Other DBs
NCBI-GeneID: 5723614
NCBI-ProteinID: XP_001697982
JGI: 195847
UniProt: A8J8W6
Position
Unknown
AA seq 320 aa AA seqDB search
MYGGGGDRGGDRGGGGGRYGGGGGGGGGGDRYGGRAIFVGNLPYDVREKELDEIFYKFGR
IRMIDIKKPARPPGFAFVEFEDPRSAEEAARRRNNYEFAGMRMRVEIARGGEAAGAQQPL
RIGYRPIRNTMGFRLYVKNLPRSASWQDLKDFVRRVCKPLYTEVFKDNRDNVVGVVEFES
KEDMKATVRKLDDTEFANPFDKGHYVRLTEDLEERGRSRSRSRSRSRGRERDRARDRSRS
RSRSKSRSRSRSRSPKRDSKSRSRSRSPAAEGGAKSKSRSRSRTRSRSRSKSRSKSRSRS
PPPADNGKEERKEGDAPADD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtatggtggcggtggcgaccgcggtggcgaccgcggtggtggcggtggccgctacggt
ggaggtggaggtggaggtggcggtggcgaccgttatggtggccgtgccatcttcgtgggc
aacctgccctacgatgtgcgcgagaaggagcttgatgagattttctacaagttcggccgc
attcgcatgattgatatcaagaagcctgctcgcccgccgggcttcgcgtttgtcgagttc
gaggacccccggtctgccgaggaggccgcccgccgccgcaacaactacgagtttgcgggc
atgcgcatgcgtgtggagattgcccgcggtggcgaggccgccggcgcgcagcagccgctg
cgcatcggctaccgccccatccgcaacaccatgggcttccgcctgtacgtgaagaacctg
ccccgctccgccagctggcaggacctcaaggactttgtccgccgcgtgtgcaagccgctg
tacacggaggtgttcaaggacaaccgcgacaacgtggtcggcgtggtggagttcgagagc
aaggaggacatgaaggccaccgtccgcaagctggacgacaccgagttcgccaaccccttc
gacaagggccactacgtgcgcctgaccgaggacctggaggagcgaggccgctcccgctcc
cgcagccgctcccgctcccgcggccgcgagcgggaccgcgcccgcgaccgctcccgcagc
aggtcccgctccaagtcgcgctcgcgctcccgctcgcgcagccccaagcgcgacagcaag
agccgctcgcgctcccgcagccccgctgccgagggcggcgccaagtccaagtcgaggtcc
cgctcccgcacccggtctcgctcgcgctctaagtcgcgctccaagtcgcgctctcgcagc
cccccgcccgccgacaacggcaaggaggagcgcaaggagggcgacgccccggccgacgac
tga

DBGET integrated database retrieval system