KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195847Help
Entry
CHLREDRAFT_195847 CDS       T01039                                 

Gene name
SRP36
Definition
SR protein factor
Orthology
K12890  
splicing factor, arginine/serine-rich 1/9
Organism
cre  Chlamydomonas reinhardtii
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    CHLREDRAFT_195847 (SRP36)
Spliceosome [BR:cre03041]
 Common components
  Common spliceosomal components
   SR proteins
    CHLREDRAFT_195847 (SRP36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 320 aa AA seqDB search
MYGGGGDRGGDRGGGGGRYGGGGGGGGGGDRYGGRAIFVGNLPYDVREKELDEIFYKFGR
IRMIDIKKPARPPGFAFVEFEDPRSAEEAARRRNNYEFAGMRMRVEIARGGEAAGAQQPL
RIGYRPIRNTMGFRLYVKNLPRSASWQDLKDFVRRVCKPLYTEVFKDNRDNVVGVVEFES
KEDMKATVRKLDDTEFANPFDKGHYVRLTEDLEERGRSRSRSRSRSRGRERDRARDRSRS
RSRSKSRSRSRSRSPKRDSKSRSRSRSPAAEGGAKSKSRSRSRTRSRSRSKSRSKSRSRS
PPPADNGKEERKEGDAPADD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtatggtggcggtggcgaccgcggtggcgaccgcggtggtggcggtggccgctacggt
ggaggtggaggtggaggtggcggtggcgaccgttatggtggccgtgccatcttcgtgggc
aacctgccctacgatgtgcgcgagaaggagcttgatgagattttctacaagttcggccgc
attcgcatgattgatatcaagaagcctgctcgcccgccgggcttcgcgtttgtcgagttc
gaggacccccggtctgccgaggaggccgcccgccgccgcaacaactacgagtttgcgggc
atgcgcatgcgtgtggagattgcccgcggtggcgaggccgccggcgcgcagcagccgctg
cgcatcggctaccgccccatccgcaacaccatgggcttccgcctgtacgtgaagaacctg
ccccgctccgccagctggcaggacctcaaggactttgtccgccgcgtgtgcaagccgctg
tacacggaggtgttcaaggacaaccgcgacaacgtggtcggcgtggtggagttcgagagc
aaggaggacatgaaggccaccgtccgcaagctggacgacaccgagttcgccaaccccttc
gacaagggccactacgtgcgcctgaccgaggacctggaggagcgaggccgctcccgctcc
cgcagccgctcccgctcccgcggccgcgagcgggaccgcgcccgcgaccgctcccgcagc
aggtcccgctccaagtcgcgctcgcgctcccgctcgcgcagccccaagcgcgacagcaag
agccgctcgcgctcccgcagccccgctgccgagggcggcgccaagtccaagtcgaggtcc
cgctcccgcacccggtctcgctcgcgctctaagtcgcgctccaagtcgcgctctcgcagc
cccccgcccgccgacaacggcaaggaggagcgcaaggagggcgacgccccggccgacgac
tga

DBGET integrated database retrieval system