KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195895Help
Entry
CHLREDRAFT_195895 CDS       T01039                                 

Gene name
RB60
Definition
protein disulfide isomerase 1 (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CHLREDRAFT_195895 (RB60)
Enzymes [BR:cre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CHLREDRAFT_195895 (RB60)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CHLREDRAFT_195895 (RB60)
  Exosomal proteins of colorectal cancer cells
   CHLREDRAFT_195895 (RB60)
  Exosomal proteins of bladder cancer cells
   CHLREDRAFT_195895 (RB60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 532 aa AA seqDB search
MNRWNLLALTLGLLLVAAPFTKHQFAHASDEYEDDEEDDAPAAPKDDDVDVTVVTVKNWD
ETVKKSKFALVEFYAPWCGHCKTLKPEYAKAATALKAAAPDALIAKVDATQEESLAQKFG
VQGYPTLKWFVDGELASDYNGPRDADGIVGWVKKKTGPPAVTVEDADKLKSLEADAEVVV
VGYFKALEGEIYDTFKSYAAKTEDVVFVQTTSADVAKAAGLDAVDTVSVVKNFAGEDRAT
AVLATDIDTDSLTAFVKSEKMPPTIEFNQKNSDKIFNSGINKQLILWTTADDLKADAEIM
TVFREASKKFKGQLVFVTVNNEGDGADPVTNFFGLKGATSPVLLGFFMEKNKKFRMEGEF
TADNVAKFAESVVDGTAQAVLKSEAIPEDPYEDGVYKIVGKTVESVVLDETKDVLLEVYA
PWCGHCKKLEPIYKKLAKRFKKVDSVIIAKMDGTENEHPEIEVKGFPTILFYPAGSDRTP
IVFEGGDRSLKSLTKFIKTNAKIPYELPKKGSDGDEGTSDDKDKPASDKDEL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttggaaccttcttgcccttaccctggggctgctgctggtggcagcgcccttc
accaagcaccagtttgctcatgcttccgatgagtatgaggacgacgaggaggacgatgcc
cccgccgcccctaaggacgacgacgtcgacgttactgtggtgaccgtcaagaactgggat
gagaccgtcaagaagtccaagttcgcgcttgtggagttctacgctccttggtgcggccac
tgcaagaccctcaagcctgagtacgctaaggctgccaccgccctgaaggctgctgctccc
gatgcccttatcgccaaggtcgacgccacccaggaggagtccctggcccagaagttcggc
gtgcagggctaccccaccctcaagtggttcgttgatggcgagctggcttctgactacaac
ggcccccgcgacgctgatggcattgttggctgggtgaagaagaagactggcccccccgcc
gtgaccgttgaggacgccgacaagctgaagtccctggaggcggacgctgaggtcgttgtc
gtcggctacttcaaggccctggagggcgagatctacgacaccttcaagtcctacgccgcc
aagaccgaggacgtggtgttcgtgcagaccaccagcgccgacgtcgccaaggccgccggc
ctggacgccgtggacaccgtgtccgtggtcaagaacttcgccggtgaggaccgcgccacc
gccgtcctggccacggacatcgacactgactccctgaccgcgttcgtcaagtcggagaag
atgccccccaccattgagttcaaccagaagaactctgacaagatcttcaacagcggcatc
aacaagcagctgattctgtggaccaccgccgacgacctgaaggccgacgccgagatcatg
actgtgttccgcgaggccagcaagaagttcaagggccagctggtgttcgtgaccgtcaac
aacgagggcgacggcgccgaccccgtcaccaacttcttcggcctcaagggcgccacctcg
cctgtgctgctgggcttcttcatggagaagaacaagaagttccgcatggagggcgagttc
acggctgacaacgtggctaagttcgccgagagcgtggtggacggcaccgcgcaggccgtg
ctcaagtcggaggccatccccgaggacccctatgaggatggcgtctacaagattgtgggc
aagaccgtggagtctgtggttctggacgagaccaaggacgtgctgctggaggtgtacgcc
ccctggtgcggccactgcaagaagctggagcccatctacaagaagctggccaagcgcttt
aagaaggtggattccgtcatcatcgccaagatggatggcactgagaacgagcaccccgag
atcgaggtcaagggcttccctaccatcctgttctatcccgccggcagcgaccgcaccccc
atcgtgttcgagggcggcgaccgctcgctcaagtccctgaccaagttcatcaagaccaac
gccaagatcccgtacgagctgcccaagaagggctccgacggcgacgagggcacctcggac
gacaaggacaagcccgcgtccgacaaggacgagctgtaa

DBGET integrated database retrieval system