KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195902Help
Entry
CHLREDRAFT_195902 CDS       T01039                                 

Gene name
DNJ3
Definition
(RefSeq) DnaJ-like protein
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 535 aa AA seqDB search
MGSHGPISCLCCRAHVEDGAAAGVHAGRRARSLIATVAVVLLLAAAQAPGAEAFRRGGGG
GGGGRDFYSLLGVAKDADEATIKKAYRRQALKWHPDRNTDKKEEAAARFRDIAAAYEVLS
DADKRRTYDQFGEEGLKHGGGGGPGGPGGAGGFNMNFQGGDPFEMFNMFFGGGGGGGGMG
GGMGGQRRAQFNMGGGGMGGGFGGMGGGGMGGGGRGGHSGGGGEGLYDDDPHVQTLTTDT
FPAGDTAWVWLVEFYAPWCGHCKQLAPKWSAVAKSLKGVVKVGAINCEDAKELCGAHGVR
GYPTIQAFVPGSGAKPYSGDRSAKAISDWALDLVPSRVSQITTDLSLRQLLARCSGGSSS
GSSGSSSKGKDRASWSACVMLVSAKSETPHLLRALSVAYAGKVAFGELRVGSGKGAGGAL
SAPMAHVASQLGVDVEAERAAGKLPLLITICNGDLALVDRWVDSLARHLDTYAAGKKCAK
QVRLDAGTDLGKFSAGQLKQLVKDKGLDCRGCTEKDDFVRRLKDFIASGGAAGTR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccatggtcctataagctgcttgtgctgtagagcgcacgtggaggatggggca
gcagcgggcgtgcacgcggggcgacgggcccggtcgctcatagccactgttgcggtagtg
ctgctgctcgcggcggcccaggctccgggcgcggaagccttccgtcgcggtggtggcggc
ggcggcggcggccgcgacttctactcgctgctaggtgtggcgaaggacgcggacgaggcc
accattaagaaggcgtaccggcggcaggcgctcaagtggcaccccgaccgcaacaccgac
aagaaggaggaggcggcggcgcgattccgcgacatcgccgccgcctatgaggtgctgagc
gatgccgacaagcgccgcacgtacgaccagtttggtgaagagggactgaagcatggtggc
ggcggcggcccaggcggcccaggcggcgccggcggcttcaacatgaatttccagggggga
gatccatttgagatgttcaacatgttctttggtggcggcggcggtggcggcggcatgggc
ggcggcatgggcggacagcggcgcgcgcagttcaacatgggtggcggcggcatgggtggc
ggctttgggggcatgggtggcggcggcatgggcggcggcggccgcggtggtcacagcggc
ggcggcggcgagggcttgtacgatgatgacccgcacgtgcagacgctgactacggacacg
ttcccggcgggcgacactgcctgggtgtggctggttgagttctacgccccatggtgcggg
cactgtaaacagctggcgcccaagtggtcggctgtggccaagtcgctgaagggcgtggtc
aaggtgggcgcgatcaactgtgaggacgccaaagagttgtgcggtgcacacggcgtgcgc
ggctaccccaccatccaggccttcgtgccgggctccggcgccaagccctacagcggcgac
cgctccgccaaggccatctccgactgggccctggacctggtgcccagccgcgtgtcacag
atcaccaccgacctctccctgcgccagctgctggcacgctgctccggcggcagtagcagt
ggcagcagtggcagtagcagcaagggcaaggaccgggccagctggagcgcgtgcgtgatg
ctggtcagcgccaaatccgagacgccgcacctgctgcgcgcgctgtcggtcgcatacgct
ggcaaggtggcgtttggcgagctgcgggtgggcagcggcaagggcgccggcggcgccctg
tctgcgcccatggcccacgtggcgtcgcagctgggtgtggacgtggaggcggagcgggcc
gccggcaagctgccgctgctcatcaccatctgcaacggcgacctggcgctggtggacagg
tgggtggactcgctggcccggcacctggacacctacgccgccggcaagaagtgcgccaag
caggtgcggctggacgccggcacggacctgggcaagttcagtgcggggcagctcaagcag
ctggtcaaggacaaggggctggactgcaggggctgcacggagaaggacgacttcgtgcgg
cggctcaaggacttcatcgcgagcggcggagcggccgggacacgatga

DBGET integrated database retrieval system