KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195902Help
Entry
CHLREDRAFT_195902 CDS       T01039                                 

Gene name
DNJ3
Definition
DnaJ-like protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cre04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 535 aa AA seqDB search
MGSHGPISCLCCRAHVEDGAAAGVHAGRRARSLIATVAVVLLLAAAQAPGAEAFRRGGGG
GGGGRDFYSLLGVAKDADEATIKKAYRRQALKWHPDRNTDKKEEAAARFRDIAAAYEVLS
DADKRRTYDQFGEEGLKHGGGGGPGGPGGAGGFNMNFQGGDPFEMFNMFFGGGGGGGGMG
GGMGGQRRAQFNMGGGGMGGGFGGMGGGGMGGGGRGGHSGGGGEGLYDDDPHVQTLTTDT
FPAGDTAWVWLVEFYAPWCGHCKQLAPKWSAVAKSLKGVVKVGAINCEDAKELCGAHGVR
GYPTIQAFVPGSGAKPYSGDRSAKAISDWALDLVPSRVSQITTDLSLRQLLARCSGGSSS
GSSGSSSKGKDRASWSACVMLVSAKSETPHLLRALSVAYAGKVAFGELRVGSGKGAGGAL
SAPMAHVASQLGVDVEAERAAGKLPLLITICNGDLALVDRWVDSLARHLDTYAAGKKCAK
QVRLDAGTDLGKFSAGQLKQLVKDKGLDCRGCTEKDDFVRRLKDFIASGGAAGTR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccatggtcctataagctgcttgtgctgtagagcgcacgtggaggatggggca
gcagcgggcgtgcacgcggggcgacgggcccggtcgctcatagccactgttgcggtagtg
ctgctgctcgcggcggcccaggctccgggcgcggaagccttccgtcgcggtggtggcggc
ggcggcggcggccgcgacttctactcgctgctaggtgtggcgaaggacgcggacgaggcc
accattaagaaggcgtaccggcggcaggcgctcaagtggcaccccgaccgcaacaccgac
aagaaggaggaggcggcggcgcgattccgcgacatcgccgccgcctatgaggtgctgagc
gatgccgacaagcgccgcacgtacgaccagtttggtgaagagggactgaagcatggtggc
ggcggcggcccaggcggcccaggcggcgccggcggcttcaacatgaatttccagggggga
gatccatttgagatgttcaacatgttctttggtggcggcggcggtggcggcggcatgggc
ggcggcatgggcggacagcggcgcgcgcagttcaacatgggtggcggcggcatgggtggc
ggctttgggggcatgggtggcggcggcatgggcggcggcggccgcggtggtcacagcggc
ggcggcggcgagggcttgtacgatgatgacccgcacgtgcagacgctgactacggacacg
ttcccggcgggcgacactgcctgggtgtggctggttgagttctacgccccatggtgcggg
cactgtaaacagctggcgcccaagtggtcggctgtggccaagtcgctgaagggcgtggtc
aaggtgggcgcgatcaactgtgaggacgccaaagagttgtgcggtgcacacggcgtgcgc
ggctaccccaccatccaggccttcgtgccgggctccggcgccaagccctacagcggcgac
cgctccgccaaggccatctccgactgggccctggacctggtgcccagccgcgtgtcacag
atcaccaccgacctctccctgcgccagctgctggcacgctgctccggcggcagtagcagt
ggcagcagtggcagtagcagcaagggcaaggaccgggccagctggagcgcgtgcgtgatg
ctggtcagcgccaaatccgagacgccgcacctgctgcgcgcgctgtcggtcgcatacgct
ggcaaggtggcgtttggcgagctgcgggtgggcagcggcaagggcgccggcggcgccctg
tctgcgcccatggcccacgtggcgtcgcagctgggtgtggacgtggaggcggagcgggcc
gccggcaagctgccgctgctcatcaccatctgcaacggcgacctggcgctggtggacagg
tgggtggactcgctggcccggcacctggacacctacgccgccggcaagaagtgcgccaag
caggtgcggctggacgccggcacggacctgggcaagttcagtgcggggcagctcaagcag
ctggtcaaggacaaggggctggactgcaggggctgcacggagaaggacgacttcgtgcgg
cggctcaaggacttcatcgcgagcggcggagcggccgggacacgatga

DBGET integrated database retrieval system