KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195943Help
Entry
CHLREDRAFT_195943 CDS       T01039                                 

Gene name
UROS
Definition
uroporphyrinogen-iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHLREDRAFT_195943 (UROS)
Enzymes [BR:cre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CHLREDRAFT_195943 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 297 aa AA seqDB search
MAMRTCNRPFSAAGTKASAAAPCRALRGASARRCHVSVYASSGSPKVLLTREEGKNDKLR
AALTRKGYTCLELPLIAHTDGPDRPLLPALLRAAADQYEWVAITSPEGASVFLEGWAAAG
KPKLRVAAVGGGTGEALQAGGVTPEYVPSKALGKVMGSELPRVPGGSRRVLYPASVKAST
DLQDSLTEAGFEVHRINTYNTTSVASVPEALLREALTADVVTYGSPSAVKAWVGLAGLEA
ANAKVNACIGSTSARACANAGITQHVYFPDAPGIEGWVEAVEKGCREAKLPLPVAAV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgcggacctgcaaccgtccctttagcgcagcgggcacgaaggcatcggcagct
gctccctgccgcgcgctgcgcggtgcctcagcgcgccggtgtcacgtgtcggtgtacgcc
agctccggatcgcccaaggtgctgctgacgcgcgaggaggggaagaacgacaagctgcgt
gccgcgctgacacgcaaggggtacacgtgcctggagctgccgctgatcgcgcacacggat
ggacccgaccggccgctactgccggcgctgctgcgcgccgccgcggatcagtacgagtgg
gtggccatcacctcgcccgagggggcgtccgtgttcctggagggctgggcggcggcgggc
aagcccaagctgcgcgtggctgcggtgggcggcggcacgggggaggcgctccaggcgggc
ggcgtgacgcccgagtacgtgccatccaaggctctgggcaaggtgatgggcagcgagttg
ccgcgggtgccgggcggcagccgccgcgtgctgtaccccgcgtccgtcaaggccagcacg
gacctgcaggactccctgacggaggcgggcttcgaggtgcaccgcatcaacacctacaac
acgacatctgtcgcgtccgttcccgaggcgctgctgcgggaggcgttgacggctgacgtg
gtcacgtacggcagcccctccgccgtcaaggcctgggtggggctggcgggcctggaggca
gccaacgccaaggtgaacgcctgcatcggctccacctccgcccgggcctgtgccaacgcc
ggcatcacccagcacgtgtacttccccgacgcccccggcatcgagggctgggtggaggcg
gtggagaagggctgccgcgaggcgaagctgccgctgcccgtcgccgcggtctga

DBGET integrated database retrieval system