KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_196328Help
Entry
CHLREDRAFT_196328 CDS       T01039                                 

Gene name
MAS1
Definition
(RefSeq) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00620  Pyruvate metabolism
cre00630  Glyoxylate and dicarboxylate metabolism
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
cre01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHLREDRAFT_196328 (MAS1)
   00630 Glyoxylate and dicarboxylate metabolism
    CHLREDRAFT_196328 (MAS1)
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CHLREDRAFT_196328 (MAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 5721289
NCBI-ProteinID: XP_001695632
JGI: 196328
UniProt: Q6X898
Position
Unknown
AA seq 546 aa AA seqDB search
MSVQTIPGVAILGPVTAEQASILSPEAQLFVATLHRTFNPRRKELLKRRDERQKDLDAGR
LPDFLPETAAVRADPGWKCAPPAPGLVDRRVEITGPVDRKMVINALNSGATQYMADFEDS
HAPTWDGNLEGQVNMRDAVRRAISYTGPNGKVYSLRTDGKLATLLVRPRGWHLVEAHFMV
DGEPCSASLFDFGLFFFHNAAATLAAGQGPYFYLPKMESHLEARLWNDVFNASQDMLRLP
RGTVRATVLIETLLAAFEMEEILYELRDHSSGLNCGRWDYIFSFIKKLRNHPQFVLPDRS
AVTMTSPFMDAYVRLLIKTCHKRGVHAMGGMAAQIPIKDDPAANAAALAKVRGDKEREVV
AGHDGTWVAHPALVPIAMEIFNKHMPTPNQLHVRRDDVTVTAHNLLDVRGGALLAEGGIT
EKGLRDNLSVGLAYMENWLRGVGCVPIHNLMEDAATAEISRSAVWQWVRHHARTRDGRVV
TAAWVNDLLAQELDQLKSKMGAERFARSKYPLAAQLFQSTITGDAYSDFLTTLCYDHIVT
KTPSRM
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccaaaccattccgggtgtggctatcctcgggccagtcaccgcagagcaggcg
agcatcctgtcgccagaggcccagcttttcgtcgcgacgctgcaccgcaccttcaacccg
cgccgcaaggagttgctcaagcgtcgcgatgagcgccagaaggacctggatgctgggcgc
ctgcccgacttcctgcctgagacggcggcggtgcgcgccgaccccggctggaagtgcgcc
ccgcccgcacccggcctggtggaccggcgcgtggagatcacggggccggtggaccgcaag
atggtgatcaacgccctcaacagcggtgccacacagtacatggccgactttgaggactcg
cacgcgcccacgtgggacggcaacctggaggggcaggtgaacatgcgtgacgccgtgcgc
cgcgccatcagctacaccggacccaacggcaaggtctacagcctgcgcactgacggcaag
ctggccacgctgctggtccgcccccgcggctggcatctggtggaggcccacttcatggtg
gatggcgagccctgttccgcctcgctgttcgacttcggcctgttcttcttccacaacgct
gccgccaccctagcggccgggcagggcccctacttctacctgcccaagatggagagccat
ctggaggccaggctgtggaacgacgtgttcaacgccagccaggacatgctgcggctgccg
cgcggcactgtgcgtgccacggtgctgatcgagacgctgctggccgcctttgagatggag
gagatcctgtacgagctgagggaccactcgtcgggcctgaactgcggccgctgggactac
atcttcagcttcatcaagaagctgcgcaaccacccgcagtttgtgctgccagaccgctcc
gccgtcaccatgacctcgcccttcatggacgcctacgtgcgactgctcatcaagacctgc
cacaagcgcggcgtgcacgccatgggcggcatggcggcgcagatccccatcaaggacgac
cccgcagcaaacgccgccgcgctggccaaggtccgcggcgacaaggagcgcgaggtggtg
gccgggcacgacggcacgtgggtggcgcaccccgccctggtgcccatcgccatggagatt
ttcaacaagcacatgcccacgcccaaccagctgcacgtgcggcgcgacgacgtgacggtg
acggcgcacaacctgctggacgtgcgcggcggggcgctgctggcggagggcggcatcacg
gagaagggtctgcgcgacaacctgtcggtgggcctggcctacatggagaactggctgcgg
ggcgtgggctgcgtgcccatccacaacctcatggaggacgccgccaccgccgagatcagc
aggtctgctgtgtggcagtgggtgcggcaccacgcgcgcactcgcgacggccgtgtggtg
acggcggcctgggtgaacgacctgctggcgcaggagctggaccagctgaagagcaagatg
ggcgccgagcgcttcgcccgctccaagtaccctctggctgctcagctgttccagagcacc
atcaccggcgacgcctactcggacttcctcaccaccctgtgctatgaccacatcgtcacc
aagacccccagccgcatgtga

DBGET integrated database retrieval system