KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_196430Help
Entry
CHLREDRAFT_196430 CDS       T01039                                 

Gene name
PFK2
Definition
(RefSeq) phosphofructokinase family protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00010  Glycolysis / Gluconeogenesis
cre00030  Pentose phosphate pathway
cre00051  Fructose and mannose metabolism
cre00052  Galactose metabolism
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
cre01200  Carbon metabolism
cre01230  Biosynthesis of amino acids
cre03018  RNA degradation
Module
cre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_196430 (PFK2)
   00030 Pentose phosphate pathway
    CHLREDRAFT_196430 (PFK2)
   00051 Fructose and mannose metabolism
    CHLREDRAFT_196430 (PFK2)
   00052 Galactose metabolism
    CHLREDRAFT_196430 (PFK2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CHLREDRAFT_196430 (PFK2)
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHLREDRAFT_196430 (PFK2)
Protein phosphatases and associated proteins [BR:cre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHLREDRAFT_196430 (PFK2)
Messenger RNA biogenesis [BR:cre03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CHLREDRAFT_196430 (PFK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK MTD
Motif
Other DBs
NCBI-GeneID: 5719698
NCBI-ProteinID: XP_001694148
JGI: 196430
UniProt: A8IYM0
Position
Unknown
AA seq 512 aa AA seqDB search
MLLQRHAPGFTKVPSRQCKPSVPIARQPRSSVCARATPGADLTTNYVIEPVSFGEDAVLE
CPEMRSKLVVRPSPFVTHNNFGGGFVSDQDRVALNSMRFASPDSAGASRSNFFPHGGKGG
INVLEASMDQLNMTLPPWAIRAGARREIYFDPSQTTAAIVTCGGLCPGLNDVVQGLVNKL
TDYGVPEGKILGIKYGFRGFYDPQVKPIVLSKRVVDGIQLQGGTILGTSRGGANIREIVK
RIDMWGIDMLFVVGGNGGNAGANAINAMCRQHDVPCSVVGVPKSIDNDILLIDKCFGFDT
AVEESQRALMAAKVEASSARKGIGLVKLMGRQSGFIAMQASMASGVVDACLIPEVNFKLD
GDNGLLKYLDGVIKAKGHAVVCVAEGAGQDILEDGGQIGTDASGNPILKDIGAFLKDKFK
AYFKDADIKYIDPSYMIRSVSTTTNDRIYCKILAHNAVHAAFAGFTGITVGLVNTHYVYL
PIPVIIQAPRKVDPRGKAWNRLRAAIGQPSFQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgcagcgccatgcgccaggcttcaccaaggttccgtctcggcagtgcaaaccg
agcgtaccgattgcaaggcaaccgcgcagcagcgtgtgtgctcgcgccactcccggagca
gatctgaccacgaactatgttatcgagccagtcagctttggtgaggatgccgttttggaa
tgcccggagatgcggtcgaagctggtggtcaggcccagcccctttgtcactcacaacaac
ttcggtggcggcttcgtgtctgaccaggaccgtgtggcgttgaactccatgcgctttgcc
tcccccgactccgcgggcgccagccgctccaacttcttcccgcacggcggcaagggcggc
atcaacgtgctggaggcgtccatggaccagctgaacatgacgctgccgccctgggccatc
cgcgcgggggcgaggcgggagatctacttcgacccctcgcagaccaccgccgccatcgtc
acgtgcggcggcctgtgccccggcctcaatgacgtcgtacagggcctggtgaacaagctg
actgactacggcgtgcccgagggcaagatcctgggcatcaagtacggattcaggggcttc
tacgacccgcaggtaaagcccatcgtgctgagcaagcgcgtggtggacggcatccagctg
cagggcgggaccatcctgggcaccagccgcggaggagccaacatcagggagatcgtgaag
cgcattgacatgtggggcattgacatgctctttgtggtgggcggcaacggtggcaacgcg
ggcgccaacgccatcaacgctatgtgccggcagcacgacgtgccctgctccgtggtgggc
gtgcccaagtccatcgacaacgacatcctgctcatcgacaagtgctttggcttcgacacg
gcggtggaggagagccagcgcgcgctcatggcggcaaaggttgaggccagcagcgcgcgc
aagggcatcggcctggtcaagctgatgggccgccagtcgggattcatcgccatgcaggcc
tccatggccagcggtgtggtggacgcctgcctcatccccgaggtcaacttcaagctggac
ggcgacaacgggctgctcaagtacctggacggcgtcatcaaggccaaggggcacgcggtg
gtgtgcgtggcggagggcgcggggcaggacattctggaggacggcggccagatcggcacc
gacgccagcggcaaccccatcctcaaggacatcggcgccttcctcaaggacaagttcaag
gcctacttcaaggacgcagacatcaagtacatcgacccctcctacatgatccgctccgtg
tccaccaccaccaacgaccgcatctactgcaagatcctggcgcacaacgccgtgcacgcc
gccttcgccggcttcaccggcatcaccgtgggcctggtcaacacgcactacgtctacctg
cccatcccggtcatcatccaggcgccgcgcaaggtggacccgcgcggcaaggcctggaac
cgcctgcgtgccgccatcggccagcccagcttccagtaa

DBGET integrated database retrieval system