KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_196430Help
Entry
CHLREDRAFT_196430 CDS       T01039                                 

Gene name
PFK2
Definition
phosphofructokinase family protein (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLREDRAFT_196430 (PFK2)
   01230 Biosynthesis of amino acids
    CHLREDRAFT_196430 (PFK2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_196430 (PFK2)
   00030 Pentose phosphate pathway
    CHLREDRAFT_196430 (PFK2)
   00051 Fructose and mannose metabolism
    CHLREDRAFT_196430 (PFK2)
   00052 Galactose metabolism
    CHLREDRAFT_196430 (PFK2)
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CHLREDRAFT_196430 (PFK2)
Protein phosphatases and associated proteins [BR:cre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHLREDRAFT_196430 (PFK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 512 aa AA seqDB search
MLLQRHAPGFTKVPSRQCKPSVPIARQPRSSVCARATPGADLTTNYVIEPVSFGEDAVLE
CPEMRSKLVVRPSPFVTHNNFGGGFVSDQDRVALNSMRFASPDSAGASRSNFFPHGGKGG
INVLEASMDQLNMTLPPWAIRAGARREIYFDPSQTTAAIVTCGGLCPGLNDVVQGLVNKL
TDYGVPEGKILGIKYGFRGFYDPQVKPIVLSKRVVDGIQLQGGTILGTSRGGANIREIVK
RIDMWGIDMLFVVGGNGGNAGANAINAMCRQHDVPCSVVGVPKSIDNDILLIDKCFGFDT
AVEESQRALMAAKVEASSARKGIGLVKLMGRQSGFIAMQASMASGVVDACLIPEVNFKLD
GDNGLLKYLDGVIKAKGHAVVCVAEGAGQDILEDGGQIGTDASGNPILKDIGAFLKDKFK
AYFKDADIKYIDPSYMIRSVSTTTNDRIYCKILAHNAVHAAFAGFTGITVGLVNTHYVYL
PIPVIIQAPRKVDPRGKAWNRLRAAIGQPSFQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgcagcgccatgcgccaggcttcaccaaggttccgtctcggcagtgcaaaccg
agcgtaccgattgcaaggcaaccgcgcagcagcgtgtgtgctcgcgccactcccggagca
gatctgaccacgaactatgttatcgagccagtcagctttggtgaggatgccgttttggaa
tgcccggagatgcggtcgaagctggtggtcaggcccagcccctttgtcactcacaacaac
ttcggtggcggcttcgtgtctgaccaggaccgtgtggcgttgaactccatgcgctttgcc
tcccccgactccgcgggcgccagccgctccaacttcttcccgcacggcggcaagggcggc
atcaacgtgctggaggcgtccatggaccagctgaacatgacgctgccgccctgggccatc
cgcgcgggggcgaggcgggagatctacttcgacccctcgcagaccaccgccgccatcgtc
acgtgcggcggcctgtgccccggcctcaatgacgtcgtacagggcctggtgaacaagctg
actgactacggcgtgcccgagggcaagatcctgggcatcaagtacggattcaggggcttc
tacgacccgcaggtaaagcccatcgtgctgagcaagcgcgtggtggacggcatccagctg
cagggcgggaccatcctgggcaccagccgcggaggagccaacatcagggagatcgtgaag
cgcattgacatgtggggcattgacatgctctttgtggtgggcggcaacggtggcaacgcg
ggcgccaacgccatcaacgctatgtgccggcagcacgacgtgccctgctccgtggtgggc
gtgcccaagtccatcgacaacgacatcctgctcatcgacaagtgctttggcttcgacacg
gcggtggaggagagccagcgcgcgctcatggcggcaaaggttgaggccagcagcgcgcgc
aagggcatcggcctggtcaagctgatgggccgccagtcgggattcatcgccatgcaggcc
tccatggccagcggtgtggtggacgcctgcctcatccccgaggtcaacttcaagctggac
ggcgacaacgggctgctcaagtacctggacggcgtcatcaaggccaaggggcacgcggtg
gtgtgcgtggcggagggcgcggggcaggacattctggaggacggcggccagatcggcacc
gacgccagcggcaaccccatcctcaaggacatcggcgccttcctcaaggacaagttcaag
gcctacttcaaggacgcagacatcaagtacatcgacccctcctacatgatccgctccgtg
tccaccaccaccaacgaccgcatctactgcaagatcctggcgcacaacgccgtgcacgcc
gccttcgccggcttcaccggcatcaccgtgggcctggtcaacacgcactacgtctacctg
cccatcccggtcatcatccaggcgccgcgcaaggtggacccgcgcggcaaggcctggaac
cgcctgcgtgccgccatcggccagcccagcttccagtaa

DBGET integrated database retrieval system