KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_196500Help
Entry
CHLREDRAFT_196500 CDS       T01039                                 

Gene name
DLA2
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00010  Glycolysis / Gluconeogenesis
cre00020  Citrate cycle (TCA cycle)
cre00620  Pyruvate metabolism
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
cre01200  Carbon metabolism
Module
cre_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_196500 (DLA2)
   00020 Citrate cycle (TCA cycle)
    CHLREDRAFT_196500 (DLA2)
   00620 Pyruvate metabolism
    CHLREDRAFT_196500 (DLA2)
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CHLREDRAFT_196500 (DLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 PYNP_C CBP_CCPA
Motif
Other DBs
NCBI-GeneID: 5723016
NCBI-ProteinID: XP_001697507
JGI: 196500
UniProt: A8J7F6
Position
Unknown
AA seq 415 aa AA seqDB search
MQATTRVPAKSGVSSSAKRVAASGRRVLVVPNAVKDVFMPALSSTMTEGKIVSWLKNVGD
KVKKGEALVVVESDKADMDVESFADGILGAIVVQEGERAVVGAPIAFVAENANEAPAAAP
APAPAPVAAPAPPAPTPVPAAPVGRADGRIVATPYAKQLAKDLKVDLATVAGTGPNGRIT
AADATTVSELRGTTKPFSTLQAAVARNMNESLKVPEFRVSYAITTDKLDALYQQLKPKGV
TMTALLAKACGVALAKHPLLYAACTPDGNGITYSSQINVALAVAMPDGGLITPVLKNADS
TDLYQMSRNWADLVKRARSKQLQPDEYNSGNFTISNLGMYGVETFDAILPPGTAAIMAVG
GSKPTVVASPDGMIGVKKVMNVNLTADHRIVYGADAAEFLQTLKAVIENPDQLLF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccacgacccgcgtgccggccaagtccggtgtctccagctcggcgaagcgcgtt
gcggcttcgggtcgccgtgttctggtggtccccaacgcggtcaaggatgtgttcatgccc
gcgctgagctcgaccatgactgaggggaagatcgtgtcctggctgaagaatgttggcgac
aaggtcaagaagggcgaggccctggtggtcgtggagtcggacaaggctgatatggacgtc
gagtctttcgccgatggcattctgggcgcgattgtcgtccaggagggcgagcgcgcagtg
gtcggcgccccgatcgccttcgtggccgaaaacgccaacgaggccccggctgccgcgccc
gctccggcccccgccccggtcgcagccccggcgcccccggctcccaccccggtccccgcg
gcgcctgtcggccgcgcggatggccgcattgtggcgaccccctacgctaagcagctggct
aaggacctgaaggttgacctggccaccgttgccggcaccggccccaacggccgcatcact
gccgctgatgccaccaccgtgtccgagctgcgcggcaccaccaagcccttcagcaccctg
caggccgccgtggctcgcaacatgaacgagagcctgaaggtgcccgagttccgcgtgtcg
tacgccatcaccaccgacaagctggacgcgctgtaccagcagctgaagcccaagggtgtc
accatgaccgccctgctggccaaggcctgcggtgtggccctggccaagcacccgctgctg
tacgctgcttgcactcccgacggcaacggcatcacctacagcagccagattaacgtggcg
ctggccgtggccatgcccgacggcggtctgatcacccctgtgctgaagaacgcggactcc
acggacctgtaccagatgtcgcgcaactgggctgacctggtcaagcgcgctcgctccaag
cagctgcagcccgatgagtacaacagcggcaacttcaccatctccaacctgggcatgtac
ggcgtggagaccttcgacgccatcctgccgcccggcactgccgccatcatggcggtgggc
ggctccaagcccaccgtggtggccagccccgacggcatgatcggcgtgaagaaggtcatg
aacgtcaacctgacggccgaccaccgcatcgtgtacggtgccgacgccgccgagttcctg
cagacgctcaaggctgtgattgagaaccccgaccagctgctgttctaa

DBGET integrated database retrieval system