KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_196515Help
Entry
CHLREDRAFT_196515 CDS       T01039                                 

Gene name
PHOD
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cre00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 656 aa AA seqDB search
MQQGVTCTAAADWTCKLDADGLSPAVKYFYRFTAPGGVRSPVGRFHLPYPRGDARQGRVR
LAVFSCSNWGWGYFHAYGVAATYELDAWVHLGDFIYGELETGRVPRSDPNNPASNQAVRF
GLKPANEILTITDYRQRYALYRTDSSLQALSAAAPTIAIWDDHETANNAWKDGFPDAPSS
QNNITASRRAAGVQAWHEWLPVRPSGGVGSASSYTELAINRTLNFGSTLSLFLTEDRLQA
RSSPPYINGALYSSAGSLGAAVGGVAPSKWGPAEEAKDILPNPPAAIAAANASGDAANAA
FWGGVWANCSSSDVAVVNGTPTNAAGIHLYSTACYRRPYIGAELKASRGPLLASYNLSDR
TPGSPTGAGAFAGLVGGCRAIEASSRYNVILDFDAWQGFRAERDELLDIAADSNNAVFIA
GDSHVFWASVLKKANGEVVAAEFDVSSVSSVGFEELFPFMPVDMLAASLVAGGGFRGGLR
YANTDRKGFIYLAIDGEKQHADYIGIDDHCTPAGINSSFCMAGFDRYTSIERAKRGLPND
LQRTSCLTEAERVSGIVAAPPVPAYRRMGCSSYNGAKPTVFAFASGSTQLVAHAARGQSY
SVEQCATAAHAAGMKLFALNPSRTRCMGSKKSSMRKQGKRSDAGCSGAGRVPVYAL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaggcgtaacgtgcacggccgcggccgactggacctgcaagctggacgccgac
ggtctgtccccggccgtcaagtacttctaccgcttcaccgcacccggcggcgtcaggtcg
cctgtgggccgcttccacctaccctaccctcgcggcgacgcccgccagggccgtgtcagg
ctcgccgtgttctcctgctccaactggggctggggctacttccacgcgtacggcgttgcg
gccacctacgagctggacgcctgggtgcacctgggagacttcatctacggtgagttggag
accgggcgtgttccgcggtcggaccccaacaaccccgcctccaaccaggcggtgcgcttc
ggcctcaagcccgcaaacgagatcctcaccatcaccgactaccgccagcgctacgcgctc
taccgcaccgacagctcgctgcaggctctgtcggccgccgcgcccaccatcgccatctgg
gacgaccacgagaccgccaacaacgcctggaaggacggcttcccggacgcgccctcctcc
cagaacaacatcaccgccagccgccgcgccgctggtgtgcaggcctggcatgagtggctg
cccgtgcgccccagcggcggcgtgggcagcgcctccagttacaccgagctggccatcaac
cgcaccctgaacttcggatccacgctttcgctcttcctaaccgaggaccgcctgcaggct
cgctcctcgccgccctacatcaacggcgctctgtacagctcggctggctcgctgggcgct
gcggttggcggcgtggctcccagcaagtggggacccgcggaggaggccaaggacatcctg
cccaacccccccgccgccatcgccgccgccaacgccagcggtgacgccgccaacgccgcc
ttctggggcggcgtgtgggccaactgctccagcagtgacgtggcggtggttaacggcaca
cccaccaacgccgccggcatccacctctactccaccgcctgctaccgccgcccctacatc
ggtgccgagctcaaggcaagccgtgggccgctgcttgcgagttacaacctttcggaccgc
actcccggctcccccaccggcgccggcgcctttgctggcctcgtgggcggctgtcgcgcc
atcgaggcgtccagccgttacaacgtcatcctggattttgacgcctggcagggtttccgt
gctgagcgcgacgagctgcttgacatcgcagccgattccaacaacgccgtgttcattgca
ggagactcgcacgtcttctgggccagcgtgctgaagaaggccaacggcgaggtggtggcg
gcggagttcgatgtcagctccgtttccagcgtcggctttgaggagctcttccccttcatg
cccgtggatatgctggcggcgtccctggtggccggtggcggcttccgcggcggactgcgt
tacgcaaacaccgaccgcaagggtttcatctacctggccattgacggcgagaagcagcac
gccgactacattgggatcgacgaccactgcacgcccgcgggcatcaactcttctttctgt
atggccggattcgatcgctacacctccatcgagcgcgccaagcgcggcctgcctaacgac
ctccagcgcaccagctgcctgactgaggcggagcgcgtcagcggcatcgtggcggcgccg
ccggtgccggcgtaccgccgcatgggctgctcctcttacaatggagccaagcccaccgtc
ttcgccttcgccagcggcagcacccagcttgtggcccacgcggcgcgcggtcagagctac
agcgtcgagcagtgcgctactgccgcacacgcggccggcatgaagctgttcgcgctcaac
cccagccgcacacgctgcatgggaagcaagaagagcagcatgcgcaagcagggcaagcgg
agcgatgccggctgctcgggcgcgggtcgcgtgccggtgtatgcgctttga

DBGET integrated database retrieval system