KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_205994Help
Entry
CHLREDRAFT_205994 CDS       T01039                                 

Gene name
FAD5D
Definition
(RefSeq) fatty acid desaturase
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     CHLREDRAFT_205994 (FAD5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 460 aa AA seqDB search
MLRDMMHDAARSCAIRRCLLINTGTYTCKIFLHKGDLSQYPGPSYKMQALRAQTSRSPQT
YSNTCPILSRELTRCTTRRPGCVPTRATVVPCAQRQSQQGVEASRAVTSATPDAPEPVVE
RVSNSSGSRKAFAKAFTSLLGLQLAKPEDLDPDTLRNPPFPRYTPALSELSVQQLRPYFL
NRTYTDTDVGYLAFFSAMHLVALVGGPLTYSPECLQLCLAGYVVTGMLGISMSYHRQLSH
KSFRCVKPLEYLLAYCGALAFEGDPIEWSKMHRWHHLHSDTPADRHSPRDGLWHSHMGWL
FDEALNSTRRDAQGNMKDSLSPPWFYKESPAFYGWLRDTYMYHQVRSGASSSACSSPCEC
LVQQYGHMTWLVNSAVHIWGEQRYQSDDSSRNNWLVGLLVFGDGHHNNHHAFEYSAAHGL
EWWEVDMSYYMIRILELTGLAWDVKRPSATAMAAKRLPGK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgacatgatgcatgatgccgcgcggtcatgtgcaatccgcaggtgcttgctc
attaatacgggcacatacacatgtaaaatatttctgcacaagggagatctttcccagtac
cccggaccctcttacaaaatgcaagccctgcgtgcacaaacgtcgcgttctccacagacc
tactcaaacacatgtccgattctcagccgggaactgacccggtgcaccacgcggcgtcct
gggtgcgtccccactcgtgcaacagtcgtgccatgcgcgcagcggcaatcgcaacaagga
gtagaggcgtctagggcggtaacgtcggcaaccccggacgcgccagagccggtggtggag
cgcgtcagcaactcaagcggcagccgaaaggcctttgccaaggccttcacctcgctgctc
gggctgcagctggccaaacccgaggacctggatccagacacgctgcgaaacccgcccttt
ccccgctacacccccgcgctgtccgagctcagcgtgcagcagctgcggccgtacttcctc
aaccgcacctacacagacacagacgtgggctacctggccttcttctccgccatgcacctt
gtggcgctggtgggcggcccgctcacctacagcccggagtgcctgcagctgtgcctggcg
ggctacgtggtgacgggcatgctgggcatctccatgtcgtaccaccgccagctcagccac
aagtccttccgctgcgtcaagccgctcgagtacctgctggcctactgcggcgccctggcc
ttcgagggagaccccattgagtggagcaagatgcaccgctggcaccacctgcactccgac
acgcccgccgaccgccactcgccgcgggacgggctgtggcacagccacatgggctggctg
ttcgatgaggcgctcaacagcacacgccgcgacgcgcagggaaacatgaaggactcgctg
tcaccgccctggttctacaaggagagcccagccttctacggctggctgagagacacctac
atgtaccaccaggtgcggagcggggcttcgtcatccgcgtgctcttcaccatgtgagtgc
ctcgtgcagcagtacgggcacatgacgtggctggtcaactcggccgtacacatctggggc
gagcagcggtaccagtctgacgacagttcccgcaacaactggttggtgggcctgctggtg
ttcggtgatgggcaccacaacaaccaccacgccttcgagtactcggcagcccacggtctg
gagtggtgggaggtggacatgtcgtactacatgattcggatcctggagctgacagggctg
gcatgggacgtgaagaggccctcggccacggcgatggcggccaaacggctgccgggcaaa
tag

DBGET integrated database retrieval system