KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_206199Help
Entry
CHLREDRAFT_206199 CDS       T01039                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cre  Chlamydomonas reinhardtii
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CHLREDRAFT_206199
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CHLREDRAFT_206199
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CHLREDRAFT_206199
Enzymes [BR:cre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     CHLREDRAFT_206199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 451 aa AA seqDB search
SPVGNNADHAKEGDTVNTLVKELLRIFTRKVPGSLVPDELVRGFVHAYKQLGGTQERLDF
FRLITRELGLSAVCANQPGTGWQLLAEWFSVGLLHLQHISWEESPAALLERVMRAEAVHP
LGGSWEELRRRLGPRRRVFAFTHPCMPGEPLVVLHTALMNRPAACIDDILSHHDRAGEPP
AACSPTPAAASSSAASGPTTAVFYSISSSQPGLKGIELGHFLIQRVAERLTAEHPSLRQL
VTLSPLPNFRSWLTSQLQQQLMLPQAAAGSASSGASPQQQSEQTQPQPLLLPAEQVAVVG
LARAMGWRDAANAEATAAAALSGPFAHPPQPEAAVQPPPPAAPGKAVCPGPDADAVLRPV
LMRLAARYLVCEKRRSFALCPVANFHLRNGASLWRINWRADTSHLGLRRSLGIMCNYHYQ
LDSVYDNNRRYLLQHEVTTHPQVHELLSRQQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
tcgccagtagggaataatgcagatcacgctaaggaaggcgatacggtcaacacgctggtg
aaggagctcctgaggatattcacgcgaaaggttccaggctcgctggtgcctgacgagctg
gtgcggggctttgtccacgcctacaagcagctggggggcacgcaggagcgattggacttc
tttcgcctgatcacacgggagctggggctgtccgctgtttgtgccaatcagccaggcacc
ggatggcagctgctggccgagtggttcagtgtggggctgctgcacctgcagcacatctca
tgggaggagtcgccggcggccttgctggagcgggtgatgcgggcggaggcggtgcatccg
ctgggcggcagctgggaagagctgcggcggcggctgggcccgcggcggcgcgtgttcgcg
ttcacgcacccctgcatgccgggagagccgctggtggtgctgcacaccgcgctcatgaac
cggccagctgcctgcattgacgacatcctgtcgcaccacgaccgcgccggtgagccgccg
gccgcctgttcccccacgcccgccgccgcttcctcctccgccgcctccggccccaccact
gccgtgttctactccatctcgtccagccagcccgggctcaagggcatcgagctgggccac
ttcctcatccagcgggtcgccgagaggctcacggccgagcatcccagcctgcggcagctg
gtgacgctgtcgccgctgcccaacttccggtcctggctcacgtcgcagctgcagcagcag
ctgatgctgccgcaggcggcagccggcagcgccagcagcggcgccagtccccagcagcaa
tccgagcagacgcaaccgcaaccgctcctgctgccggctgagcaggtggcagtggtgggc
ctggcgcgagccatgggctggcgtgatgccgccaacgccgaggccacggccgccgccgcg
ctctcaggccccttcgcgcacccgccccagcccgaagcggcagtccagccgccgcctcca
gctgcgccgggcaaagctgtgtgcccgggcccggacgccgatgcggtgctgcggccggtg
ctgatgcggctggcggcgcggtacctggtgtgtgagaagcggcggtcctttgcgctgtgc
cccgtggccaacttccacctgcgcaatggggcgtcgctgtggcgcatcaactggagggct
gacacgagccatctgggcctgcgccgcagcttgggcatcatgtgcaactaccactaccag
ctggatagtgtgtacgacaacaacaggcggtacctgctgcagcatgaggtgacgacgcac
ccgcaagtgcacgagcttctcagtcgccagcagtga

DBGET integrated database retrieval system