KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_24172Help
Entry
CHLREDRAFT_24172  CDS       T01039                                 

Gene name
EIF4E
Definition
eukaryotic initiation factor
Orthology
K03259  
translation initiation factor 4E
Organism
cre  Chlamydomonas reinhardtii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CHLREDRAFT_24172 (EIF4E)
Messenger RNA biogenesis [BR:cre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CHLREDRAFT_24172 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CHLREDRAFT_24172 (EIF4E)
Translation factors [BR:cre03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CHLREDRAFT_24172 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 202 aa AA seqDB search
MADGREEGEIDSVEPDFSKKHPLENRWTLWFDNPNQKQTQKQYGQSLRSVYTFDTVEDFW
CLYNNIRTPSQVNVGATYYLFKEGIEPKWEDPKNLKGGSWTAPVPNKGDSKKTLDAWWLN
TVLACIGEQFTDGDEVNGIAVVIRARGDRIELWSRTASNEAAQTMIGKQLKQYLDIPESA
KIGFSVFEEKITSGKAKDRYMV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggtcgcgaggagggcgagattgactctgtggagcctgacttcagcaagaag
caccccctagagaaccgctggaccctgtggttcgataaccccaaccagaagcagacgcag
aagcagtatgggcagtcactcagatcggtgtacaccttcgacaccgtggaggacttctgg
tgcctgtacaacaacatccgcacccccagccaagtgaatgtgggcgcgacgtactatctc
ttcaaggaggggatagagcccaagtgggaggacccgaagaacctgaagggcggcagctgg
accgcgccggtgcccaacaagggcgacagtaagaagacgctggacgcctggtggctcaat
acggtgctggcctgcatcggcgagcagttcactgatggtgatgaggtgaacggcattgcc
gtggtcatccgcgcgcgcggtgaccgcattgagctctggtcgcgcaccgcctcgaacgag
gctgcccagaccatgattggcaagcagctgaagcagtaccttgacattcccgagtccgct
aagattggcttctccgtcttcgaggagaagatcacctcgggcaaggccaaggaccgctac
atggtgtaa

DBGET integrated database retrieval system