KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_24172Help
Entry
CHLREDRAFT_24172  CDS       T01039                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic initiation factor
  KO
K03259  
translation initiation factor 4E
Organism
cre  Chlamydomonas reinhardtii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CHLREDRAFT_24172 (EIF4E)
Messenger RNA biogenesis [BR:cre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CHLREDRAFT_24172 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CHLREDRAFT_24172 (EIF4E)
Translation factors [BR:cre03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CHLREDRAFT_24172 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 202 aa AA seqDB search
MADGREEGEIDSVEPDFSKKHPLENRWTLWFDNPNQKQTQKQYGQSLRSVYTFDTVEDFW
CLYNNIRTPSQVNVGATYYLFKEGIEPKWEDPKNLKGGSWTAPVPNKGDSKKTLDAWWLN
TVLACIGEQFTDGDEVNGIAVVIRARGDRIELWSRTASNEAAQTMIGKQLKQYLDIPESA
KIGFSVFEEKITSGKAKDRYMV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggtcgcgaggagggcgagattgactctgtggagcctgacttcagcaagaag
caccccctagagaaccgctggaccctgtggttcgataaccccaaccagaagcagacgcag
aagcagtatgggcagtcactcagatcggtgtacaccttcgacaccgtggaggacttctgg
tgcctgtacaacaacatccgcacccccagccaagtgaatgtgggcgcgacgtactatctc
ttcaaggaggggatagagcccaagtgggaggacccgaagaacctgaagggcggcagctgg
accgcgccggtgcccaacaagggcgacagtaagaagacgctggacgcctggtggctcaat
acggtgctggcctgcatcggcgagcagttcactgatggtgatgaggtgaacggcattgcc
gtggtcatccgcgcgcgcggtgaccgcattgagctctggtcgcgcaccgcctcgaacgag
gctgcccagaccatgattggcaagcagctgaagcagtaccttgacattcccgagtccgct
aagattggcttctccgtcttcgaggagaagatcacctcgggcaaggccaaggaccgctac
atggtgtaa

DBGET integrated database retrieval system