KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_24459Help
Entry
CHLREDRAFT_24459  CDS       T01039                                 

Gene name
FBA3
Definition
fructose-1,6-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01623  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:cre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cre00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cre00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cre00051]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:cre00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 377 aa AA seqDB search
MALMMKSSASLKAVSAGRSRRAVVVRAGKYDEELIKTAGTVASKGRGILAMDESNATCGK
RLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNI
VPGIKVDKGLVPLSNTNGESWCMGLDGLDKRCAEYYKAGARFAKWRSVVSIPHGPSIIAA
RDCAYGLARYAAIAQNAGLVPIVEPEVLLDGEHDIDRCLEVQEAIWAETFKYMADNKVMF
EGILLKPAMVTPGADCKNKAGPAKVAEYTLKMLRRRVPPAVPGIMFLSGGQSELESTLNL
NAMNQSPNPWHVSFSYARALQNTVLKTWQGKPENVQAAQAALLKRAKANSDAQQGKYDAT
TEGKEAAQGMYEKGYVY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatgatgaagtcgtcggccagcctgaaggctgtgtccgctggccgctctcgc
cgcgccgtcgttgtgcgcgccggcaagtacgatgaggagctgattaagaccgctggcacc
gttgcctccaagggccgcggtatcctggccatggacgagtccaacgccacctgcggcaag
cgcctggactccatcggcgtggagaacaccgaggagaaccgccgcgcctaccgcgagctg
ctggtgaccgcccccggcctgggccagtacatctccggcgctatcctgttcgaggagacc
ctgtatcagtccaccgcctccggcaagaagttcgtcgatgtgatgaaggagcagaacatc
gtgcccggcatcaaggtcgacaagggcctggtgcccctgtccaacaccaacggtgagagc
tggtgcatgggcctggacggcctggacaagcgctgcgctgagtactacaaggccggcgct
cgcttcgccaagtggcgctcggtcgtctcgatcccccacggcccctcgatcatcgctgcc
cgcgactgcgcctacggcctggcccgctacgccgccatcgcccagaacgccggtctggtg
cccattgtggagcccgaggtcctgctggacggtgagcacgacatcgaccgctgcctggag
gtgcaggaggccatctgggccgagaccttcaagtacatggccgacaacaaggtcatgttc
gagggtatcctgctgaagcccgccatggtcacccccggcgctgactgcaagaacaaggcc
ggccccgccaaggttgccgagtacaccctgaagatgctgcgccgccgcgtgccccccgcc
gtccccggcatcatgttcctgtcgggcggccagtccgagctggagtcgaccctgaacctg
aacgccatgaaccagagccccaacccgtggcacgtgtcgttctcgtacgcccgcgctctg
cagaacaccgttctgaagacctggcagggcaagcccgagaacgtccaggcggcccaggct
gcgctgctcaagcgcgccaaggccaactcggacgctcagcagggcaagtacgacgccacc
accgagggcaaggaggctgcccagggcatgtacgagaagggctacgtctactaa

DBGET integrated database retrieval system