KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_24459Help
Entry
CHLREDRAFT_24459  CDS       T01039                                 

Gene name
FBA3
Definition
fructose-1,6-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01623  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLREDRAFT_24459 (FBA3)
   01230 Biosynthesis of amino acids
    CHLREDRAFT_24459 (FBA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_24459 (FBA3)
   00030 Pentose phosphate pathway
    CHLREDRAFT_24459 (FBA3)
   00051 Fructose and mannose metabolism
    CHLREDRAFT_24459 (FBA3)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHLREDRAFT_24459 (FBA3)
Enzymes [BR:cre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CHLREDRAFT_24459 (FBA3)
Exosome [BR:cre04147]
 Exosomal proteins
  Proteins found in most exosomes
   CHLREDRAFT_24459 (FBA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 377 aa AA seqDB search
MALMMKSSASLKAVSAGRSRRAVVVRAGKYDEELIKTAGTVASKGRGILAMDESNATCGK
RLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNI
VPGIKVDKGLVPLSNTNGESWCMGLDGLDKRCAEYYKAGARFAKWRSVVSIPHGPSIIAA
RDCAYGLARYAAIAQNAGLVPIVEPEVLLDGEHDIDRCLEVQEAIWAETFKYMADNKVMF
EGILLKPAMVTPGADCKNKAGPAKVAEYTLKMLRRRVPPAVPGIMFLSGGQSELESTLNL
NAMNQSPNPWHVSFSYARALQNTVLKTWQGKPENVQAAQAALLKRAKANSDAQQGKYDAT
TEGKEAAQGMYEKGYVY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatgatgaagtcgtcggccagcctgaaggctgtgtccgctggccgctctcgc
cgcgccgtcgttgtgcgcgccggcaagtacgatgaggagctgattaagaccgctggcacc
gttgcctccaagggccgcggtatcctggccatggacgagtccaacgccacctgcggcaag
cgcctggactccatcggcgtggagaacaccgaggagaaccgccgcgcctaccgcgagctg
ctggtgaccgcccccggcctgggccagtacatctccggcgctatcctgttcgaggagacc
ctgtatcagtccaccgcctccggcaagaagttcgtcgatgtgatgaaggagcagaacatc
gtgcccggcatcaaggtcgacaagggcctggtgcccctgtccaacaccaacggtgagagc
tggtgcatgggcctggacggcctggacaagcgctgcgctgagtactacaaggccggcgct
cgcttcgccaagtggcgctcggtcgtctcgatcccccacggcccctcgatcatcgctgcc
cgcgactgcgcctacggcctggcccgctacgccgccatcgcccagaacgccggtctggtg
cccattgtggagcccgaggtcctgctggacggtgagcacgacatcgaccgctgcctggag
gtgcaggaggccatctgggccgagaccttcaagtacatggccgacaacaaggtcatgttc
gagggtatcctgctgaagcccgccatggtcacccccggcgctgactgcaagaacaaggcc
ggccccgccaaggttgccgagtacaccctgaagatgctgcgccgccgcgtgccccccgcc
gtccccggcatcatgttcctgtcgggcggccagtccgagctggagtcgaccctgaacctg
aacgccatgaaccagagccccaacccgtggcacgtgtcgttctcgtacgcccgcgctctg
cagaacaccgttctgaagacctggcagggcaagcccgagaacgtccaggcggcccaggct
gcgctgctcaagcgcgccaaggccaactcggacgctcagcagggcaagtacgacgccacc
accgagggcaaggaggctgcccagggcatgtacgagaagggctacgtctactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system