KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_24459Help
Entry
CHLREDRAFT_24459  CDS       T01039                                 

Gene name
FBA3
Definition
(RefSeq) fructose-1,6-bisphosphate aldolase (EC:4.1.2.13)
  KO
K01623  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLREDRAFT_24459 (FBA3)
   01230 Biosynthesis of amino acids
    CHLREDRAFT_24459 (FBA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_24459 (FBA3)
   00030 Pentose phosphate pathway
    CHLREDRAFT_24459 (FBA3)
   00051 Fructose and mannose metabolism
    CHLREDRAFT_24459 (FBA3)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHLREDRAFT_24459 (FBA3)
Enzymes [BR:cre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CHLREDRAFT_24459 (FBA3)
Exosome [BR:cre04147]
 Exosomal proteins
  Proteins found in most exosomes
   CHLREDRAFT_24459 (FBA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 377 aa AA seqDB search
MALMMKSSASLKAVSAGRSRRAVVVRAGKYDEELIKTAGTVASKGRGILAMDESNATCGK
RLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNI
VPGIKVDKGLVPLSNTNGESWCMGLDGLDKRCAEYYKAGARFAKWRSVVSIPHGPSIIAA
RDCAYGLARYAAIAQNAGLVPIVEPEVLLDGEHDIDRCLEVQEAIWAETFKYMADNKVMF
EGILLKPAMVTPGADCKNKAGPAKVAEYTLKMLRRRVPPAVPGIMFLSGGQSELESTLNL
NAMNQSPNPWHVSFSYARALQNTVLKTWQGKPENVQAAQAALLKRAKANSDAQQGKYDAT
TEGKEAAQGMYEKGYVY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccctgatgatgaagtcgtcggccagcctgaaggctgtgtccgctggccgctctcgc
cgcgccgtcgttgtgcgcgccggcaagtacgatgaggagctgattaagaccgctggcacc
gttgcctccaagggccgcggtatcctggccatggacgagtccaacgccacctgcggcaag
cgcctggactccatcggcgtggagaacaccgaggagaaccgccgcgcctaccgcgagctg
ctggtgaccgcccccggcctgggccagtacatctccggcgctatcctgttcgaggagacc
ctgtatcagtccaccgcctccggcaagaagttcgtcgatgtgatgaaggagcagaacatc
gtgcccggcatcaaggtcgacaagggcctggtgcccctgtccaacaccaacggtgagagc
tggtgcatgggcctggacggcctggacaagcgctgcgctgagtactacaaggccggcgct
cgcttcgccaagtggcgctcggtcgtctcgatcccccacggcccctcgatcatcgctgcc
cgcgactgcgcctacggcctggcccgctacgccgccatcgcccagaacgccggtctggtg
cccattgtggagcccgaggtcctgctggacggtgagcacgacatcgaccgctgcctggag
gtgcaggaggccatctgggccgagaccttcaagtacatggccgacaacaaggtcatgttc
gagggtatcctgctgaagcccgccatggtcacccccggcgctgactgcaagaacaaggcc
ggccccgccaaggttgccgagtacaccctgaagatgctgcgccgccgcgtgccccccgcc
gtccccggcatcatgttcctgtcgggcggccagtccgagctggagtcgaccctgaacctg
aacgccatgaaccagagccccaacccgtggcacgtgtcgttctcgtacgcccgcgctctg
cagaacaccgttctgaagacctggcagggcaagcccgagaacgtccaggcggcccaggct
gcgctgctcaagcgcgccaaggccaactcggacgctcagcagggcaagtacgacgccacc
accgagggcaaggaggctgcccagggcatgtacgagaagggctacgtctactaa

DBGET integrated database retrieval system