KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_26265Help
Entry
CHLREDRAFT_26265  CDS       T01039                                 

Gene name
TPIC
Definition
(RefSeq) triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00010  Glycolysis / Gluconeogenesis
cre00051  Fructose and mannose metabolism
cre00562  Inositol phosphate metabolism
cre00710  Carbon fixation in photosynthetic organisms
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
cre01200  Carbon metabolism
cre01230  Biosynthesis of amino acids
Module
cre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cre_M00002  Glycolysis, core module involving three-carbon compounds
cre_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_26265 (TPIC)
   00051 Fructose and mannose metabolism
    CHLREDRAFT_26265 (TPIC)
   00562 Inositol phosphate metabolism
    CHLREDRAFT_26265 (TPIC)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHLREDRAFT_26265 (TPIC)
Enzymes [BR:cre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CHLREDRAFT_26265 (TPIC)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CHLREDRAFT_26265 (TPIC)
  Exosomal proteins of bladder cancer cells
   CHLREDRAFT_26265 (TPIC)
  Exosomal proteins of melanoma cells
   CHLREDRAFT_26265 (TPIC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5715343
NCBI-ProteinID: XP_001690035
JGI: 26265
UniProt: Q5S7Y5
Structure
PDB: 

Jmol
Position
Unknown
AA seq 282 aa AA seqDB search
MQLCKVQRASAARSSRASRSQRVEVVCASSAKFFVGGNWKCNGSVANVAKLVDELNAGTI
PRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVI
LGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVD
EVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSV
SDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttgcaaggttcagcgtgccagtgccgctcgcagctcgcgggcgagccgtagc
cagcgtgttgaggtcgtgtgtgccagcagcgccaagttcttcgtgggtggcaactggaag
tgcaacggcagcgtggcaaacgtcgcaaagcttgtcgatgagctcaacgctggcactatc
cctcggggtgtggacgtggttgtggcccctcccttcatttacatcgactacgtcatgcag
cacctcgaccgggacaagtaccagctctcggctcagaacgcttggatcggcggcaatggt
gccttcaccggcgaggtcagcgctgagcagctgactgatttcggcgtgccgtgggttatt
ctgggtcactcggagcgccgctcgctattcggcgagtccaacgaggtggtggcgaagaag
acttcgcacgccctggccgcgggtctcggtgtaatcgcctgcattggcgagactctcgag
cagcgcaacagcggctctgtgttcaaggttctggacgcccagatggatgcacttgttgac
gaggtgaaggactggactaaggtcgtgctcgcgtatgagccagtgtgggccatcggcacg
ggcgtggtggcgtcgccggagcaggcgcaggaggtgcacgcctacctgcgccaatactgc
gctaagaagctcggcgcggctgtcgccgacaagctccgcatcatctatggcggctccgtc
agcgacaccaactgcaaggacctctcgaagcaggaggacattgacggcttcctggtcggc
ggcgcctcgctaaagggcgcggcattcgtaacgatctgcaacgctgcggggcctaaggcg
aagccgtaa

DBGET integrated database retrieval system