KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_26265Help
Entry
CHLREDRAFT_26265  CDS       T01039                                 

Gene name
TPIC
Definition
(RefSeq) triose phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLREDRAFT_26265 (TPIC)
   01230 Biosynthesis of amino acids
    CHLREDRAFT_26265 (TPIC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_26265 (TPIC)
   00051 Fructose and mannose metabolism
    CHLREDRAFT_26265 (TPIC)
   00562 Inositol phosphate metabolism
    CHLREDRAFT_26265 (TPIC)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHLREDRAFT_26265 (TPIC)
Enzymes [BR:cre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CHLREDRAFT_26265 (TPIC)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CHLREDRAFT_26265 (TPIC)
  Exosomal proteins of bladder cancer cells
   CHLREDRAFT_26265 (TPIC)
  Exosomal proteins of melanoma cells
   CHLREDRAFT_26265 (TPIC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 282 aa AA seqDB search
MQLCKVQRASAARSSRASRSQRVEVVCASSAKFFVGGNWKCNGSVANVAKLVDELNAGTI
PRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVI
LGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVD
EVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSV
SDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttgcaaggttcagcgtgccagtgccgctcgcagctcgcgggcgagccgtagc
cagcgtgttgaggtcgtgtgtgccagcagcgccaagttcttcgtgggtggcaactggaag
tgcaacggcagcgtggcaaacgtcgcaaagcttgtcgatgagctcaacgctggcactatc
cctcggggtgtggacgtggttgtggcccctcccttcatttacatcgactacgtcatgcag
cacctcgaccgggacaagtaccagctctcggctcagaacgcttggatcggcggcaatggt
gccttcaccggcgaggtcagcgctgagcagctgactgatttcggcgtgccgtgggttatt
ctgggtcactcggagcgccgctcgctattcggcgagtccaacgaggtggtggcgaagaag
acttcgcacgccctggccgcgggtctcggtgtaatcgcctgcattggcgagactctcgag
cagcgcaacagcggctctgtgttcaaggttctggacgcccagatggatgcacttgttgac
gaggtgaaggactggactaaggtcgtgctcgcgtatgagccagtgtgggccatcggcacg
ggcgtggtggcgtcgccggagcaggcgcaggaggtgcacgcctacctgcgccaatactgc
gctaagaagctcggcgcggctgtcgccgacaagctccgcatcatctatggcggctccgtc
agcgacaccaactgcaaggacctctcgaagcaggaggacattgacggcttcctggtcggc
ggcgcctcgctaaagggcgcggcattcgtaacgatctgcaacgctgcggggcctaaggcg
aagccgtaa

DBGET integrated database retrieval system