KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_26265Help
Entry
CHLREDRAFT_26265  CDS       T01039                                 

Gene name
TPIC
Definition
triose phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:cre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cre00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cre00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cre00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:cre00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 282 aa AA seqDB search
MQLCKVQRASAARSSRASRSQRVEVVCASSAKFFVGGNWKCNGSVANVAKLVDELNAGTI
PRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVI
LGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVD
EVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSV
SDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttgcaaggttcagcgtgccagtgccgctcgcagctcgcgggcgagccgtagc
cagcgtgttgaggtcgtgtgtgccagcagcgccaagttcttcgtgggtggcaactggaag
tgcaacggcagcgtggcaaacgtcgcaaagcttgtcgatgagctcaacgctggcactatc
cctcggggtgtggacgtggttgtggcccctcccttcatttacatcgactacgtcatgcag
cacctcgaccgggacaagtaccagctctcggctcagaacgcttggatcggcggcaatggt
gccttcaccggcgaggtcagcgctgagcagctgactgatttcggcgtgccgtgggttatt
ctgggtcactcggagcgccgctcgctattcggcgagtccaacgaggtggtggcgaagaag
acttcgcacgccctggccgcgggtctcggtgtaatcgcctgcattggcgagactctcgag
cagcgcaacagcggctctgtgttcaaggttctggacgcccagatggatgcacttgttgac
gaggtgaaggactggactaaggtcgtgctcgcgtatgagccagtgtgggccatcggcacg
ggcgtggtggcgtcgccggagcaggcgcaggaggtgcacgcctacctgcgccaatactgc
gctaagaagctcggcgcggctgtcgccgacaagctccgcatcatctatggcggctccgtc
agcgacaccaactgcaaggacctctcgaagcaggaggacattgacggcttcctggtcggc
ggcgcctcgctaaagggcgcggcattcgtaacgatctgcaacgctgcggggcctaaggcg
aagccgtaa

DBGET integrated database retrieval system