KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_31Help
Entry
CHLREDRAFT_31     CDS       T01039                                 

Gene name
PYR2
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CHLREDRAFT_31 (PYR2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CHLREDRAFT_31 (PYR2)
Enzymes [BR:cre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CHLREDRAFT_31 (PYR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 272 aa AA seqDB search
MSTLFYEPSTRTRLSFESAMSRLGGTVLSTESAGEYSSAAKGETLEDTVRTVEGYADCIV
IRHSQEGSAKRAAAVASVPILNAGDGPGQHPTQALLDLYTIQREIGRLENIKIGMVGDLA
NGRTVRSLCMCLSMYPGVEVFFVAPDVVRMRDDVKDYLTKRGVKWTEVSDLREVAGLVDV
LYQTRIQRERFTDMDSYNAARGKYIIDKELMKILQPHAVVMHPLPRVDEITTDVDSDPRA
AYFRQARNGLYVRMALLKLCLADKMTADDLNK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgctattctacgagccgtcgacccgcacgcgcctctcgtttgagtcggcgatg
agccggctgggtggcacggtgctttcaaccgaaagtgccggcgagtactcgtcggccgct
aagggcgagacgctcgaggacacggttcgcacggtggagggctacgcggactgcattgtg
attcggcactcccaggagggcagcgccaagcgcgccgccgccgtggcgtccgtgcccatc
ctcaacgccggcgacggacccggccagcaccccacccaggctctgctggacttgtacacc
atccagcgcgagattgggcggctggagaacatcaagatcggcatggtgggcgacctggcc
aacggccgcaccgtgcgcagcctgtgcatgtgcctgtccatgtacccgggcgtggaggtc
ttcttcgtggcgccggacgtggtgcgcatgcgcgacgacgtcaaggattacctgaccaag
cgcggcgtcaagtggacggaggtgtcggacctgcgggaggtggcggggctggtggacgtg
ctgtaccagacccgcatccagcgcgagcgcttcacggacatggactcctacaacgccgca
cgcggcaagtacatcatcgacaaggagctgatgaagatcctgcagccgcacgccgtggtc
atgcacccactgccgcgtgtggacgagatcaccacggacgtggactcggacccgcgcgct
gcctacttccgccaggctcgcaacggcctgtacgtgcgcatggcgctgctcaagctgtgc
ctggccgacaagatgaccgctgatgacctgaacaagtag

DBGET integrated database retrieval system