KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_78072Help
Entry
CHLREDRAFT_78072  CDS       T01039                                 

Gene name
MAPK3
Definition
mitogen-activated protein kinase 3 (EC:2.7.1.-)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 383 aa AA seqDB search
MSQTGDKPPTGSQAGSQGSSSSNIPVPQECDIPGKARFSLWRTTFEIDTRYVPIKAIGKG
AYGVVASAKDSVTGEKVAIKKIGNAFENLTDARRTLREIKLLRHLKHDNIIAVKDILKPP
AKDKFNDVYLVYELMDTDLHQIIRSSQPLTNEHFQYFVYQVLRGLKYVHTANVLHRDLKP
SNLLLNASCDLKICDFGLARTGSERNFMTEYVVTRWYRAPELLLSCEHYTSAIDMWSVGC
IMAELLGRKPLLPGKDYVDQLKLIIKSLGPPSEDDLTFINSQKARAYIRALPPAEKVNFR
KKFPEADPLAIDLMEKMLQFDPRKRIDVHGALKHPWLAQLHDEAAEPAAPGEFVLDFEES
TLTEQNVRDLIYEELVNHYHPND
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaacgggtgacaagccaccgacaggttctcaagcagggtcgcaaggcagctct
tcaagcaatatcccggtgccgcaagaatgcgatatcccgggcaaagcgcgctttagcctc
tggagaactacgtttgagatagacactagatatgtgccaattaaggcgatcggaaaggga
gcttacggtgtcgtggcgtccgcaaaagacagtgtaaccggggaaaaggtggctatcaaa
aagattgggaatgcattcgagaacctgaccgatgctcggcggactttgcgtgagatcaag
ctcctccggcacttgaaacacgacaacatcatcgccgtgaaggacatcctcaagccgccg
gccaaggacaagttcaatgacgtgtacctggtgtacgagctgatggacacggacctgcac
cagatcatccgctcctcgcagccactcacaaacgaacactttcagtacttcgtctaccag
gtgctccgcgggctcaagtacgtgcacacggccaacgtgctgcaccgcgacctcaaaccc
agcaacctgctgctgaacgcgtcgtgtgacctgaagatatgcgacttcggcctggcgcgg
acagggtcggagcgcaacttcatgactgagtacgtggtgacgcgctggtaccgcgcgccg
gagctgctgctgtcctgcgagcactacacgtccgccatcgacatgtggtccgtgggctgc
atcatggctgagctgctgggccgcaagccgctgctgccgggtaaggattacgtggaccag
ctaaagctcatcatcaagtcgctggggccgccgtcggaagacgacctcacattcatcaac
agccagaaggcacgcgcctacatccgcgcgctgccaccagctgagaaagtcaacttccgg
aagaagttcccggaggcggacccgctggccatcgacctaatggagaagatgctgcagttc
gacccccgcaagcgcattgacgtgcacggcgctctgaagcacccgtggctggcgcagctg
cacgatgaggcggcggagcctgcagcgccaggcgagttcgtgctcgacttcgaggagtcc
accctcacggagcagaacgtgcgcgacctgatctacgaggagctcgtgaatcactatcac
cccaacgactga

DBGET integrated database retrieval system