KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_80327Help
Entry
CHLREDRAFT_80327  CDS       T01039                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_80327
Enzymes [BR:cre01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CHLREDRAFT_80327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 324 aa AA seqDB search
MRGQARPSVSAARRSAVSAHRAVNVVASSVADLNKKHGIPGSVEFKEGKSGSPVVVLKHA
CGASAEMYLFGACVTSWKQPSGDEVLYVRPDAVFDKSKPISGGVPHCFPQFGPGAMQQHG
FARNLDWAVSTTSADPNPDEKDPSVEVVLTESDYTLKMWPHKFKAVYTVSLHGEQLNLQL
RVINTDDKPFDFTAALHTYIEVLEIAKAKVTGLKGLTYLCKAVDPKVPETKKEDRDAVTF
TGYTDSVYLNSPAHVELEVGTGAAVALDSTGWEDTVVWNPHLTMKDCYQHFCCVENAKFG
KAATVKPGESWTATVTMSVVDVSN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtcaggcgcgccccagcgtgtccgccgcgcggcgctcggctgtgtcggctcac
cgggccgtcaacgttgtcgccagctccgtcgctgacctgaacaagaagcacggcattccc
ggcagcgtggagttcaaggagggcaagagcggctcgccggttgtggtgttgaagcacgcc
tgcggtgcctccgccgagatgtacctgttcggcgcctgcgtgaccagctggaagcagccc
agcggtgacgaggtgctgtacgtgcgccccgacgccgtgttcgacaagtccaagcccatc
agcggtggcgtgccgcactgcttcccccagttcggccccggcgctatgcagcagcacggc
ttcgcgcgcaacctggactgggctgtgtccaccacctcggccgaccccaaccccgacgag
aaggacccctcggtggaggtggtgctgactgagagcgactacactctgaagatgtggccc
cacaagttcaaggccgtgtacaccgtgtctctgcacggcgagcagctgaacctccaactg
cgcgtcatcaacaccgatgacaagcccttcgacttcacggccgcgctgcacacctacatc
gaggtgctggagatcgcgaaggccaaggtcaccggcctcaagggcctgacctacctgtgc
aaggccgtggaccccaaggtgcctgagaccaagaaggaggaccgcgacgcggtcaccttc
accggctacaccgactcggtgtacctgaactcgcccgcgcacgtggagctggaggtgggc
accggcgccgccgtggcgctggacagcaccggctgggaggacaccgttgtgtggaaccct
cacctgaccatgaaggactgctaccagcacttctgctgcgtggagaacgccaagttcggc
aaggccgccaccgtcaagcccggggagagctggaccgccaccgtgaccatgtcggtcgtg
gacgtctccaactaa

DBGET integrated database retrieval system