KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_81238Help
Entry
CHLREDRAFT_81238  CDS       T01039                                 

Gene name
TSA1
Definition
(RefSeq) tryptophan synthetase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00260  Glycine, serine and threonine metabolism
cre00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
cre01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHLREDRAFT_81238 (TSA1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHLREDRAFT_81238 (TSA1)
Enzymes [BR:cre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHLREDRAFT_81238 (TSA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG Pterin_bind FMN_dh Spore_YtrH
Motif
Other DBs
NCBI-GeneID: 5722439
NCBI-ProteinID: XP_001696973
JGI: 81238
UniProt: A8J599
Position
Unknown
AA seq 258 aa AA seqDB search
MNALKAKGKVAFIPFICAGDPDLDTTSLALRKLDEVGADVIELGVPYSDPLADGPVIQGA
ATRALDKHTTLDKVIEMVRRTAPAMKAPLVMFTYYNPIMRKGLDNFARTIKEAGAAGLLV
PDLPLEETVSVRAACEKAGIELVLLATPTTPQARMRAIAQASQGFVYLVSVTGVTGMKEQ
VSGRVEGLVSELKAVTDKPVCVGFGVSRAEHAKQIVSWGADGVICGSALVKALGEASSPA
EGLQAMEKLARELRAATP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactgaaggcgaagggaaaggtcgcctttatccccttcatctgcgctggtgac
cccgacctggacaccacttccctggcgctgcgcaagctggatgaggttggcgcggacgtg
attgagcttggcgtgccctactcggaccccctggctgacggccctgtcattcagggcgct
gctacccgcgcgcttgataagcacaccacgctcgacaaggtgatcgagatggtgcgccgc
accgcacctgcgatgaaggcgccgctggttatgttcacctactacaaccccatcatgcgg
aagggcctggacaacttcgcccgcaccatcaaggaggctggcgctgcaggcctgctggtg
cccgacctgcctctggaggagaccgtgtcagtgcgcgcagcgtgcgagaaggcgggcatt
gagctggtgctgctggccacgcccacgacgccgcaggcgcgcatgcgggccatcgcccag
gccagccagggcttcgtgtacctggtgtcggtgaccggcgtgacgggcatgaaggagcag
gtgtcgggccgcgtggaggggttggtgtcggagctcaaggccgtcacggacaagccggtg
tgcgtcggctttggtgtgtctcgcgcggagcacgccaagcagatcgtttcgtggggcgcc
gatggtgtcatctgcggcagtgcgctggtgaaggcgctgggcgaggccagctctccggct
gagggcctccaagctatggagaagctggcgcgcgagctgcgggcggccactccgtag

DBGET integrated database retrieval system