KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_9190Help
Entry
CHLREDRAFT_9190   CDS       T01039                                 

Gene name
IGS1
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 209 aa AA seqDB search
MPRHIARATPDDEPPKTPMSALEATIRRKQRELEATIRDMGMEALDERLQSATAMPLRPA
YRLATLIAENVPMGRAVLVYEVARPTPETTSAELAELAKAYVQVGGASALVVRTDSADTP
SGLRDLFSVQQAVPKVPVLARDWLIHPLQVCEIKESGAAGALGLINQPSYAHLPSPPHPP
RPAPRFPDYWGPIPLGSGTQPRPLPPGLV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccacatcgctcgggcgacccctgacgacgagcccccgaagactcccatgagc
gcgctggaagcaaccattcgtcgcaagcagcgcgagctggaggccaccattcgtgacatg
ggcatggaggctctggacgagcggctgcagtccgccaccgccatgccgctgcggcccgcc
taccgcctggccacactcattgcggagaacgtgcccatgggccgggcggtgctggtgtac
gaggtggctcgccccacccccgagaccacctcggcggagctggcggagctggccaaggcc
tacgtgcaggtgggcggcgcctcggctctggtggtgcgcacggactctgcggacacgccc
tcgggtctgcgcgacctgttcagtgtgcagcaggcggtgcccaaggtgccggtgctggcg
cgggactggctcatccacccgctgcaggtgtgtgagatcaaggagtcgggtgcggccggc
gccctcggcctcatcaaccagccatcttatgcgcatctcccatccccgccccacccgccc
cgccccgccccacgattccctgactattggggacctattccactgggctcgggcacacaa
ccccgccccttaccccctggtttggtttga

DBGET integrated database retrieval system