KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_94079Help
Entry
CHLREDRAFT_94079  CDS       T01039                                 

Gene name
SBE3
Definition
starch branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLREDRAFT_94079 (SBE3)
Enzymes [BR:cre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CHLREDRAFT_94079 (SBE3)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHLREDRAFT_94079 (SBE3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 747 aa AA seqDB search
MEYVDEYGPISPIPNHDGTMCFKWDNTLWSAAEHFKYRWNVFKNIRAAIDQNEGGFEKFS
QGYKYYGFNRGECNGQTGIWYREWAPGAKALALVGDFNNWAPAEGHWAFKNQYGTWELFL
PDKPDGTSAIPHRTKVKARIEGADGSWQDKIPAWIKWSTQEWNEVLFNGVYWDPPEKGAP
GEVDPDKQYTFKYPRPPKPRALRIYECHVGMSSEEPKVNSYLEFRRDVLPRIRALGYNAI
QIMAIQEHAYYGSFGYHVTNFFGVSSRCGTPEELKALVDEAHRMGIIVLMDIVHSHASKN
TNDGINMFDGTDGMYFHGGPRGNHWMWDSRCFNYGNWETMRFLLSNARWWMDEYKFDGYR
FDGVTSMMYHHHGLSYTFTGNYGEYFGMNTDVDAVVYLMLVNNLLHDLFPNCVTIGEDVS
GMPAFCRPWQEGGVGFDYRLQMAIADKWIEVMKLHDDYAWNMGNLVHTLTNRRYAEACVG
YAESHDQALVGDKTIAFWLMDKDMYDFMAVPGHGAQSLVVDRGVALHKMIRLLTIALGGE
SYLNFMGNEFGHPEWIDFPRVDSYDPSTGKFVPGNGGSLHLCRRRWDLADADFLKYKFLN
AFDRAMCHLDKAFGYMSAPNTYISRKDEGDKMIVFERGDLVFVFNFHPGQSYQDYRVGCR
EAGPYKLVLSSDEEVFGGYRNNTKENDVTFQTQSGNFDNRPHSFQVYAPARTCAVYAPAE
WADKDADRKPHGIPGLGIKDLGPYFSR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgtggacgagtacggacctatctcgccgattcctaaccacgacggcacaatg
tgcttcaagtgggacaacaccctttggtccgctgccgagcacttcaagtaccgctggaac
gtgttcaagaacattcgcgccgccatcgaccagaacgagggcggcttcgagaagttctcg
cagggctacaagtactacggcttcaaccgcggcgagtgcaacggccagaccggtatctgg
taccgcgagtgggcacccggcgccaaggcattggctctggtgggcgacttcaacaactgg
gcccccgccgagggccactgggccttcaagaaccagtacggcacttgggagctgttcctg
cctgacaagcccgacggcacctcagccatcccccaccggaccaaggtgaaggcccgcatt
gagggcgcggacggctcttggcaggacaagatcccggcctggatcaagtggtccacccag
gagtggaacgaggtgctgttcaacggcgtgtactgggaccccccggagaagggcgccccc
ggcgaggtggaccccgacaagcagtacaccttcaagtacccccgcccgcccaagcctcgg
gctctgcgcatctacgagtgccacgtgggcatgagcagcgaggagcccaaggtgaacagc
tacctagagttccgccgcgacgtgctgccgcgcatccgcgccctgggctacaacgccatc
cagatcatggccatccaggagcacgcctactacggctccttcggataccacgtcaccaac
ttcttcggggtgagcagccgctgcggcacgcctgaggagctgaaggcgctggtagacgag
gcgcatcgcatgggcatcatcgtgctgatggacattgtgcacagccacgcctccaagaac
accaacgacggcatcaacatgtttgatggcaccgatggcatgtacttccacggcggcccg
cgcggcaaccactggatgtgggacagccgctgcttcaactacggcaactgggagactatg
cgcttcctgctgtccaacgcgcgctggtggatggacgagtacaagttcgacggctaccgc
ttcgacggcgtgacctcgatgatgtaccaccaccacggcctcagctacaccttcaccggc
aactacggcgagtacttcggcatgaacacggacgtggacgcggtggtgtacctcatgctg
gtcaacaacctgctgcacgacctgttccccaactgcgtcaccatcggcgaggatgtgtcg
ggcatgcccgcattctgccgcccctggcaggagggcggtgtgggcttcgactaccgcctg
cagatggccattgcggacaagtggattgaggtgatgaagctgcacgacgactacgcctgg
aacatgggcaacctggtgcacacactcaccaaccgccggtacgctgaggcgtgcgtgggc
tacgccgagtctcacgaccaggcgctggtgggcgacaagaccattgccttctggctcatg
gacaaggacatgtacgacttcatggcggtgcccggccacggcgctcagtctctggttgtg
gaccgcggcgtggcgctgcacaagatgatccgcctgctcaccattgcgctgggcggcgag
tcctacctcaacttcatgggcaacgagttcggccaccccgagtggattgacttccctcgt
gtggacagctacgacccctccaccggcaagttcgtgcccggcaacggcggcagcctgcac
ctgtgccggcggcgctgggacctggccgacgccgacttccttaagtacaagttcctcaac
gccttcgaccgcgccatgtgccacctggacaaggcgttcggctacatgtcggcccccaac
acctacatcagccgcaaggacgagggcgacaagatgattgtgtttgagcgcggcgacctg
gtgtttgtgttcaacttccaccccggccagtcgtaccaggactaccgcgtgggctgccgc
gaggccggcccctacaagctggtgttgagcagcgacgaggaggtcttcggcggctaccgc
aacaacaccaaggagaacgacgtcaccttccagacgcagtcgggcaacttcgacaaccgc
ccgcactcgttccaggtgtacgcgcccgcccgcacctgcgccgtgtacgcgccggccgag
tgggccgacaaggacgccgaccggaagccgcacggcatccccggcttgggcatcaaggac
ctgggcccctacttctcccgctaa

DBGET integrated database retrieval system