KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_9823Help
Entry
CHLREDRAFT_9823   CDS       T01039                                 

Gene name
MAA7
Definition
tryptophan synthase beta subunit (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHLREDRAFT_9823 (MAA7)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHLREDRAFT_9823 (MAA7)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHLREDRAFT_9823 (MAA7)
Enzymes [BR:cre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHLREDRAFT_9823 (MAA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 448 aa AA seqDB search
MNITAPTRLDSRPVASARSSARSVAPRVASRKSTVRIAAVAAPERPITDYQRPDANGRYG
QFGGKYVPETLIPALEQLEKDYNEAIADPAFKAEMEAILKDYVGRETPLYHAERLSAHYK
TADGGHAEIYLKREDLNHTGAHKINNSLGQALLCKRLNKQRIIAETGAGQHGVATATICA
RLGLKCIVYMGAKDMERQALNVFRMRLCGAEVRPVHSGTATLKDATSEAIRDWVTNVETT
HYILGSAAGPHPYPMMVREFQSVIGRETKVQAQEKWGGLPDIVMACVGGGSNAIGIFNEF
INDTSVRLIGVEAGGEGVNTTKHAATLTMGTPGVLHGSYSYLLQDDDGQIIDPHSISAGL
DYPGIGPEHSFLKDVKRAEYYAVTDAEALEGFQLLSKLEGIIPALETSHAIAYLEKLIPT
LKSGTRVVINCSGRGDKDVNNAMKYINP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcactgcccctactcgcctggattcccgtcccgtcgcgagcgctcgcagcagc
gctcgctcggtggcccctcgcgttgctagccgcaagtctactgttcgcattgctgctgtt
gctgcgcctgagcgcccgattaccgactaccagcgcccggacgcaaatggtcgctatggc
cagttcggcggcaagtacgtgcctgagaccctgatccctgccctggagcagctggagaag
gactacaacgaggcgattgcggaccctgcgtttaaggcggagatggaggctatcctgaag
gactacgtgggtcgcgagacgcccctttaccacgccgagcgcctgtcggcgcactacaag
accgcggacggcggccacgctgagatttacctaaagcgtgaggacctgaaccacactggc
gcgcataagatcaacaactcgctgggccaggccctgctgtgcaagcgcctgaacaagcag
cgcatcattgcggagaccggtgccggccagcacggtgtggccacggccaccatctgcgcc
cgcctgggcctgaagtgcattgtgtacatgggcgctaaggacatggagcgccaggcgctg
aacgtgttccgcatgcgcctgtgcggtgcggaggtccgccccgtgcacagcggcaccgcc
acgctgaaggatgccaccagcgaggccatccgcgactgggtcaccaacgtggagaccacc
cactacatcctggggtcggccgctggcccccacccctaccccatgatggtgcgcgagttc
cagtctgtcatcggccgcgagaccaaggtgcaggcgcaggagaagtggggcggcctgccc
gacatcgtgatggcgtgcgtgggcggcggctccaacgccatcggcatcttcaacgagttc
atcaacgacacctcggtccgcctgatcggcgtggaggccggcggtgagggcgtcaacacc
accaagcacgccgccacgctgaccatgggcacgcccggcgtgctgcacggcagctacagc
tacctgctgcaggacgatgacggccagatcattgacccccactccatcagcgccggcctg
gactaccccggcattggccccgagcactcgttcctcaaggacgtgaagcgcgcagagtac
tacgccgtcacggacgccgaggcgctggagggcttccagctgctcagcaagttggaaggc
attatccccgcgctggagaccagccacgccatcgcctacctggagaagctgatccccacg
ctcaagtcaggaacccgcgtggtcattaactgctcgggccgcggcgacaaggacgtcaac
aacgccatgaagtacatcaacccttaa

DBGET integrated database retrieval system