KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_9823Help
Entry
CHLREDRAFT_9823   CDS       T01039                                 

Gene name
MAA7
Definition
tryptophan synthase beta subunit (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cre01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cre00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cre00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 448 aa AA seqDB search
MNITAPTRLDSRPVASARSSARSVAPRVASRKSTVRIAAVAAPERPITDYQRPDANGRYG
QFGGKYVPETLIPALEQLEKDYNEAIADPAFKAEMEAILKDYVGRETPLYHAERLSAHYK
TADGGHAEIYLKREDLNHTGAHKINNSLGQALLCKRLNKQRIIAETGAGQHGVATATICA
RLGLKCIVYMGAKDMERQALNVFRMRLCGAEVRPVHSGTATLKDATSEAIRDWVTNVETT
HYILGSAAGPHPYPMMVREFQSVIGRETKVQAQEKWGGLPDIVMACVGGGSNAIGIFNEF
INDTSVRLIGVEAGGEGVNTTKHAATLTMGTPGVLHGSYSYLLQDDDGQIIDPHSISAGL
DYPGIGPEHSFLKDVKRAEYYAVTDAEALEGFQLLSKLEGIIPALETSHAIAYLEKLIPT
LKSGTRVVINCSGRGDKDVNNAMKYINP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcactgcccctactcgcctggattcccgtcccgtcgcgagcgctcgcagcagc
gctcgctcggtggcccctcgcgttgctagccgcaagtctactgttcgcattgctgctgtt
gctgcgcctgagcgcccgattaccgactaccagcgcccggacgcaaatggtcgctatggc
cagttcggcggcaagtacgtgcctgagaccctgatccctgccctggagcagctggagaag
gactacaacgaggcgattgcggaccctgcgtttaaggcggagatggaggctatcctgaag
gactacgtgggtcgcgagacgcccctttaccacgccgagcgcctgtcggcgcactacaag
accgcggacggcggccacgctgagatttacctaaagcgtgaggacctgaaccacactggc
gcgcataagatcaacaactcgctgggccaggccctgctgtgcaagcgcctgaacaagcag
cgcatcattgcggagaccggtgccggccagcacggtgtggccacggccaccatctgcgcc
cgcctgggcctgaagtgcattgtgtacatgggcgctaaggacatggagcgccaggcgctg
aacgtgttccgcatgcgcctgtgcggtgcggaggtccgccccgtgcacagcggcaccgcc
acgctgaaggatgccaccagcgaggccatccgcgactgggtcaccaacgtggagaccacc
cactacatcctggggtcggccgctggcccccacccctaccccatgatggtgcgcgagttc
cagtctgtcatcggccgcgagaccaaggtgcaggcgcaggagaagtggggcggcctgccc
gacatcgtgatggcgtgcgtgggcggcggctccaacgccatcggcatcttcaacgagttc
atcaacgacacctcggtccgcctgatcggcgtggaggccggcggtgagggcgtcaacacc
accaagcacgccgccacgctgaccatgggcacgcccggcgtgctgcacggcagctacagc
tacctgctgcaggacgatgacggccagatcattgacccccactccatcagcgccggcctg
gactaccccggcattggccccgagcactcgttcctcaaggacgtgaagcgcgcagagtac
tacgccgtcacggacgccgaggcgctggagggcttccagctgctcagcaagttggaaggc
attatccccgcgctggagaccagccacgccatcgcctacctggagaagctgatccccacg
ctcaagtcaggaacccgcgtggtcattaactgctcgggccgcggcgacaaggacgtcaac
aacgccatgaagtacatcaacccttaa

DBGET integrated database retrieval system