KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_99077Help
Entry
CHLREDRAFT_99077  CDS       T01039                                 

Definition
(RefSeq) histone acetyltransferase
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Acetyltransf_7 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 5719427
NCBI-ProteinID: XP_001693623
JGI: 99077
UniProt: A8HUP5
Position
Unknown
AA seq 279 aa AA seqDB search
MIEFGRYEMDTWYYSPYPEPYASCTKLYLCEYTLKYFRKKKTLLRHLAKLDIRHPPGGGA
GGAVTKPPISVFEVDGKKAKVYCQNLCLLSKLFLDHKTLYYDVDPFLFYVMCERDQHGYH
MVGYFSKEKSCMEDYNLACILTLPAYQRKGYGKFLIAFAYELSRREGRVGTPERPLSDLG
AVSFRSYWTRVLLEQLRNVKGDVSIKEMSDATMIRGQDIVETLQSLGLIKYWKGTHLIHA
DPRVVQEHWAKFAHQRVIEVDPACLHWQPLPAPTARKRP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttcgggcggtacgagatggacacgtggtactactcgccgtatccggagccg
tacgcctcctgcaccaagctgtacctgtgcgagtacacgctgaagtacttccggaaaaag
aagacgctgctgcgccacctggccaagctggacatccggcacccgccaggtgggggggcc
ggcggtgcggtgaccaagccgcccatcagcgtgttcgaggtggacggcaagaaggccaag
gtgtactgccagaacctgtgcctactgtccaagctgttcctggaccacaagacgctctac
tacgatgtggaccccttcctcttctacgtcatgtgcgagcgcgaccagcacggctaccac
atggtgggctacttcagcaaggagaagagctgcatggaggactacaacctggcctgcatc
ctcacgctgcccgcctaccagcgtaagggctacggcaagttcctcatcgccttcgcctac
gagctgtcgcggcgcgaggggcgcgtgggcacaccggagcgcccgctgtccgacctgggc
gcggtgagcttccgcagctactggacgcgcgtgctgctggagcagctgcgcaacgtcaag
ggcgacgtgtccatcaaggagatgagcgacgccaccatgatccgcgggcaggacattgtg
gagacgctgcagagcctgggcctgatcaagtactggaagggcacgcacctcatccacgcc
gacccacgcgtggtgcaggagcattgggccaagttcgcgcaccagcgtgtgattgaggtg
gaccctgcctgcctgcactggcagccgctgcccgcgcccaccgcgcgcaagcggccgtga

DBGET integrated database retrieval system