KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_99077Help
Entry
CHLREDRAFT_99077  CDS       T01039                                 

Definition
histone acetyltransferase
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHLREDRAFT_99077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 279 aa AA seqDB search
MIEFGRYEMDTWYYSPYPEPYASCTKLYLCEYTLKYFRKKKTLLRHLAKLDIRHPPGGGA
GGAVTKPPISVFEVDGKKAKVYCQNLCLLSKLFLDHKTLYYDVDPFLFYVMCERDQHGYH
MVGYFSKEKSCMEDYNLACILTLPAYQRKGYGKFLIAFAYELSRREGRVGTPERPLSDLG
AVSFRSYWTRVLLEQLRNVKGDVSIKEMSDATMIRGQDIVETLQSLGLIKYWKGTHLIHA
DPRVVQEHWAKFAHQRVIEVDPACLHWQPLPAPTARKRP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttcgggcggtacgagatggacacgtggtactactcgccgtatccggagccg
tacgcctcctgcaccaagctgtacctgtgcgagtacacgctgaagtacttccggaaaaag
aagacgctgctgcgccacctggccaagctggacatccggcacccgccaggtgggggggcc
ggcggtgcggtgaccaagccgcccatcagcgtgttcgaggtggacggcaagaaggccaag
gtgtactgccagaacctgtgcctactgtccaagctgttcctggaccacaagacgctctac
tacgatgtggaccccttcctcttctacgtcatgtgcgagcgcgaccagcacggctaccac
atggtgggctacttcagcaaggagaagagctgcatggaggactacaacctggcctgcatc
ctcacgctgcccgcctaccagcgtaagggctacggcaagttcctcatcgccttcgcctac
gagctgtcgcggcgcgaggggcgcgtgggcacaccggagcgcccgctgtccgacctgggc
gcggtgagcttccgcagctactggacgcgcgtgctgctggagcagctgcgcaacgtcaag
ggcgacgtgtccatcaaggagatgagcgacgccaccatgatccgcgggcaggacattgtg
gagacgctgcagagcctgggcctgatcaagtactggaagggcacgcacctcatccacgcc
gacccacgcgtggtgcaggagcattgggccaagttcgcgcaccagcgtgtgattgaggtg
gaccctgcctgcctgcactggcagccgctgcccgcgcccaccgcgcgcaagcggccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system