KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_99328Help
Entry
CHLREDRAFT_99328  CDS       T01039                                 

Gene name
PGM5
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLREDRAFT_99328 (PGM5)
   01230 Biosynthesis of amino acids
    CHLREDRAFT_99328 (PGM5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHLREDRAFT_99328 (PGM5)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHLREDRAFT_99328 (PGM5)
Enzymes [BR:cre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CHLREDRAFT_99328 (PGM5)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CHLREDRAFT_99328 (PGM5)
  Exosomal proteins of melanoma cells
   CHLREDRAFT_99328 (PGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 228 aa AA seqDB search
HTLVLIRHGQSAWNLSNRFTGWTDVDLTPEGERQALAAGRLLAAHHFRFDLVFTSVLRRA
VRTAHILEGAMGLLHVQEVKSWRLNERHYGALQGLNKAETAAKHGEEQVHIWRRSYDTRP
PPLEPNDPRHPRFDVRYGDLADEDLPATESLKDCVARSLPFWHSDIAAAVCRGRRVLVAA
HGNSLRGIVKHLDRISDQDIVQLEIPVGCPLVYELDEHLTPLRHYYLG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
cacacgctggtgctgatccggcacggccagtctgcctggaacctgagcaaccgcttcaca
ggctggacggacgtggacctcacacccgagggcgagcggcaggccctggctgcgggccgg
ctgctggccgcgcaccacttccgcttcgacctggtgttcaccagcgtgctgcggcgggcg
gtgcgcaccgcacacatcctggagggagccatggggctgctgcacgtgcaggaggtcaag
agctggcgtctgaacgagcggcactacggcgccctgcaggggctgaacaaggcggagacg
gcggccaaacacggcgaggagcaggtgcacatctggcgccgcagctacgacacacgtccg
ccgcccctggagccgaacgacccgcgccacccccggttcgatgtgcggtacggcgacctg
gcggatgaggacctgcccgccactgagagcctcaaggactgtgtggctcgcagcctgccc
ttctggcacagcgacatcgcggccgcggtgtgtcgcggccggcgggtgctggtggcggca
cacggcaacagcctgcgcggcattgtcaagcacctggaccgcatcagcgaccaggacatc
gtgcagctggagatccccgtgggttgcccgctggtgtacgagctggacgagcacctgacg
ccgctgcggcactactacctgggc

DBGET integrated database retrieval system