KEGG   Crassostrea gigas (Pacific oyster): 105320493Help
Entry
105320493         CDS       T03920                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-B-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
Enzymes [BR:crg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105320493
Peptidases [BR:crg01002]
 Serine Peptidases
  Family S33
   105320493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 339 aa AA seqDB search
MITVHAIFYPLLVFLTSITATSLYLFLKKPNLIVQYYLRVTVLWSGMKIKYVNVNGRNVC
YGERGQKQKGKSSMILLHGFSADKSMWAPLVRNLPRNIHVIALDLPGNGESEPPEEGTDL
SFKGLVHSVHQIIEALGMSDDPLHIVGLSMGGAIAGLYAAEYPQVVDRVTMMCPAMRTPE
QTAVAKEIQRAVESGDEDTILRDCPLFPQNPDEMQYLLDFAQFHKSSFIPKQILQGAVDM
RRQYHGFYLKLLKGLSAEENATLLERTAPHITVPSHIVWGQEDQVVHVSGAKILTDKLPN
CKRVDIIPRCGHAINLDRPGSKTKALLSFRGEYSKKGNR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgattaccgttcacgccatattttatcctctcctggttttcttgacctccatcacagca
acatccctctatctttttttgaagaagccaaatctaatcgtgcaatattatctaagggta
actgtcctgtggagtggaatgaaaataaagtatgtaaatgtgaatggaaggaatgtttgt
tacggggaaagaggacaaaaacagaaaggcaaatctagcatgatacttcttcatggattc
tcggctgacaaatcaatgtgggctcccctagtcagaaatctaccccggaatatccatgta
attgccttggatctaccaggtaatggagaaagtgaaccaccagaggagggaacagacttg
tcatttaagggtctggtccacagtgttcatcagataattgaggcgctaggaatgtcagat
gacccgttacatattgtgggtctgtccatgggaggggcaatagctgggctgtatgctgcg
gaatatccccaggtagtggaccgtgttaccatgatgtgtccagcaatgagaacacctgaa
cagacagctgttgccaaagagatacagagagccgtggagtctggggatgaggacaccatt
ctacgtgactgtcctttgtttcctcagaacccagatgagatgcagtacttgttagatttt
gcccagtttcacaagagcagtttcattcccaaacagatacttcaaggggctgttgatatg
aggagacagtaccatgggttttatttgaaattattaaaaggcttgtcagcagaagaaaat
gcaacactactggagaggacagcccctcatataacagtaccctcccacattgtctggggt
caggaggatcaggttgtacatgtatctggagcaaagattcttactgacaaactgccaaac
tgcaaaagagtggacattattccccgctgtggtcacgccattaatcttgacaggccaggc
tccaagactaaggcgctgttgagtttcagaggagagtactccaagaaaggaaatcgatag

DBGET integrated database retrieval system