KEGG   Crassostrea gigas (Pacific oyster): 105337802Help
Entry
105337802         CDS       T03920                                 

Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:crg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    105337802
Enzymes [BR:crg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105337802
Peptidases [BR:crg01002]
 Serine Peptidases
  Family S33
   105337802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 289 aa AA seqDB search
MALKYGNKCYDRFGDGPLLWTGKWTEMELDDQEKTRTALLFISHGLGEHFDYYDELGYFL
VNSGFRVFTHDHIGHGTSSGTHSHVGNFKEYTKLIFDHCDEMKKNYPDLPIFLFGHSIGG
AAALLAALEKPEYFKGVIISSPFVIPPKVFSSSVEMFYFKNIGARMFPQQELSHIDPNEL
SRDPKKVDRIKNDPLFHAAFKAGLWKAWLDCAAKLQKNFSSIKVSLLVLHGEADKIGDIK
FSQTLYDEAQSQDKELKIYPGCLHNPILELEEDRKQVLEDIKQWLEKRI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttaaatatgggaacaaatgttacgataggtttggagatggaccactattatgg
accgggaaatggacggaaatggaattggatgaccaagaaaaaacaaggacagctttgctg
tttatttcccatggacttggggaacactttgattattacgatgagcttggatattttctg
gtgaattctggctttcgagttttcacacacgatcacatcggccatgggactagttccgga
acacacagtcatgttggaaactttaaggaatataccaaattaatctttgaccattgcgac
gaaatgaagaaaaactaccccgatttaccaatatttctgtttggacattcaataggcggc
gctgcagctttattagcagctctagaaaaaccagaatatttcaaaggcgtcatcatttca
agtccttttgtcattcctcccaaagttttttcgtccagtgtagagatgttttactttaaa
aatatcggagcacgtatgttccctcaacaagaactttctcacatcgacccgaacgagttg
tcacgtgatcccaagaaagtggacagaattaaaaatgacccgctgttccacgcggcgttc
aaagcaggactctggaaagcttggcttgattgtgctgcaaaactgcaaaaaaatttcagt
tcgataaaagtgtcattactcgttctccatggagaagctgacaaaattggcgatataaag
ttctcccaaactctgtatgacgaggctcagagtcaggacaaagaactgaagatatatcca
ggttgtcttcataatcccatactcgaactagaagaagataggaagcaagttttggaagac
attaaacaatggctagaaaaaaggatatga

DBGET integrated database retrieval system