KEGG   Candidatus Carsonella ruddii HC isolate Thao2000: A353_0159Help
Entry
A353_0159         CDS       T02197                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
crh  Candidatus Carsonella ruddii HC isolate Thao2000
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:crh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:crh00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(121391..122710)
Genome map
AA seq 439 aa AA seqDB search
MYYNSINNKLNIKQFCNIFFSNIPKNKTLFFPFKLPFFNNKYLNYLKKLNYVNFSFEISK
LFLNNISDEDLYKILYNSYNNKKFIKLEKISNENHLLNLNNGFTLTFKDIAMIPLSNLIN
YFSFKNKKKFIIFCATSGDTGASANNSFKNIKNVKIFTFYPFNMVSNIQRKQMSTLISKN
ILNYSIIGNFDISQYFVKKIFENIKNNEKIFLLSVNSINWFRIIMQLIYYCYISIKNYNE
KKFNFIIPSGNFGNALSAYLSKKIGFPINKIIPCTNDNFYLDNYIKNNKIENILLKRTIS
PSIDISIPSNFIRLINKNFFKKKIINEINNDIFSDKIYNKHIINSIEYFYQKYNKIYDPH
TITSISSFYKDNNDNNNNNNKIVVSTSYPIKFIFSIKKIIPNIKIKFNIKKIFSLKEKYK
LFSQNFLVLINSIKKNINV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtattataacagtataaataataaattaaatattaaacaattttgtaatatttttttt
tctaatataccaaaaaataaaactttgttttttccttttaaattaccattttttaataat
aaatatttaaattatttaaaaaaattaaattatgttaatttttcttttgaaatttcaaaa
ttatttttaaataatatatctgatgaagatctttataaaattttatataatagttataac
aataaaaaatttataaaattagaaaaaattagtaacgaaaatcatttattaaatttaaat
aatggatttactttaacttttaaagatatagcaatgattcctctgtcaaatttaataaat
tatttttcttttaaaaataaaaaaaaatttattattttttgtgcaacatcaggtgataca
ggtgcatcagcaaataattcttttaaaaatattaaaaatgttaaaatttttacattttat
ccgtttaatatggtttcaaatattcaaagaaaacaaatgagtactttaatttctaaaaat
attttaaattattcaataattggaaattttgatattagtcaatattttgttaaaaaaata
tttgaaaatattaaaaataatgaaaaaatttttttattatctgtaaattctattaattgg
tttagaattataatgcaattaatatattattgttatatttctattaaaaattataatgaa
aaaaaatttaattttattatcccttcaggaaattttggtaatgctctatctgcttattta
tcaaaaaaaataggtttccctataaataaaattataccttgtacaaatgataatttttat
ttagataattatattaaaaataataaaattgaaaatattcttttaaaaagaactatttct
ccatcaattgatatatctattccttcaaattttattagattaattaataaaaattttttt
aaaaaaaaaattataaatgaaattaataatgatatattttctgataaaatttataataaa
catattataaattctatagaatatttttatcaaaaatataataaaatttatgatccacat
acgattacttcaataagttctttttataaagataataatgataataacaataacaataat
aaaatagttgtatcaacatcttatcctataaaatttattttttcgataaaaaaaattatt
ccaaatattaaaattaaatttaatattaaaaaaattttttctttaaaagaaaaatataaa
ttattttctcaaaattttttagttttaataaattctataaaaaaaaatataaatgtataa

DBGET integrated database retrieval system