KEGG   Candidatus Carsonella ruddii HC (Heteropsylla cubana): A353_057Help
Entry
A353_057          CDS       T02197                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
crh  Candidatus Carsonella ruddii HC (Heteropsylla cubana)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A353_057 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    A353_057 (hisD)
Enzymes [BR:crh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     A353_057 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44217..45449
Genome map
AA seq 410 aa AA seqDB search
MLKINNFYIKKYINIKNKVKNIIKDIKNYGENALLFYIKNIDGIFLKNVKEIFLNNYNIK
KCYFKISNYKKKIIKEIYIRLKRYHFHNLNNSWQINNKIDIIYGQKIVFIEKICVYVPGG
NTIYPSSIYMNCIPSLIFKPKFTLMLTPIKNAKISNLLISVAYINNINNILLSGGVHSLS
CVVFGTKNINKINKITGPANYYITLAKKELFGNVGIDMLAGPSELMIICDGKINPNIIAL
DFFSQLEHDVFSKCFLISNNKNYINLLYFIIYKLLKFQNNKLIIIKSLNNSFLLYKNFIN
SLELINFFSPEHLMLCLKKYNYFIDKIINCGTIFINYKTSESYGDYMIGPSHIIPTNKNS
KFSSSLNINDFCKKINIIKTINNNYSKKITSYFSKIEKFFSHFYSSLIRI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaataaataatttttatattaaaaaatacataaatataaaaaataaagttaaa
aatattataaaagatataaaaaattatggtgaaaatgcattattattttatataaaaaat
attgatggaatttttttaaaaaatgtaaaagaaatttttttaaataattataatattaaa
aaatgttattttaaaataagtaattataaaaaaaaaattataaaagaaatttatattaga
ttaaaaagatatcattttcataatttaaataattcttggcaaataaataataaaattgat
ataatttatggtcaaaaaattgtatttatagaaaaaatatgtgtttatgtacctggaggt
aacacaatttatccttcatcaatttatatgaattgtataccatctttaatttttaaacca
aaatttactttaatgttaacccctataaaaaatgctaaaatttcaaatttattaatttca
gttgcttatattaataatataaataatatattattatctggaggagttcattctcttagt
tgtgtagtatttggaactaaaaatataaataaaataaataaaataactggtcctgctaat
tattatattacattagcaaaaaaagaattatttggtaatgtaggaatagatatgttagca
ggaccttctgaattaatgataatttgtgatggaaaaattaacccaaatataatagcgtta
gattttttttctcaattagaacatgatgttttttcaaaatgttttttaatttcaaacaat
aaaaattatattaatttattatattttataatatataaattattaaaatttcaaaacaat
aaattaataataattaaatctttaaataatagttttttattatataaaaattttataaat
tctttagaattaataaattttttttctccagaacatttaatgttatgtttaaaaaaatat
aattattttattgataaaataattaattgtggaactatttttataaattataaaactagt
gaatcatatggagattatatgattggacctagtcatattatacctactaacaaaaattct
aaattttcttcttcattaaatattaatgatttttgtaaaaaaattaatataattaaaaca
attaataataattattctaaaaaaattacttcatatttttcaaaaattgaaaaatttttt
tctcatttttattcatctttaataagaatatga

DBGET integrated database retrieval system