KEGG   Carnobacterium sp. 17-4: CAR_c01050Help
Entry
CAR_c01050        CDS       T01452                                 

Gene name
glpK1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CAR_c01050 (glpK1)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CAR_c01050 (glpK1)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAR_c01050 (glpK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
107753..109303
Genome map
AA seq 516 aa AA seqDB search
MKAYYIIGGNKMTKEYIMSIDQGTTSSRAIIFDKAGNPKWSSQKEFTQHFPQPGWVEHDA
NEIWISVLSVIAGVLIESGLKPSDIDSIGITNQRETTVVWDKATGRPIYRAIVWQSKQTN
DIADQLKQDGHTKLIKDKTGLVIDSYFSATKIKWILDHVEGSRKRAQKGELLFGTIDSWL
VWKLTGGKAHVTDYSNASRTMLFNIYDLKWDEDILALLDIPKEMLPEVKSSSEVYGKTIP
EHFYGGQIPIAGMAGDQQAALFGQVGYEKGMVKNTYGTGAFIIMNTGKEPIKSDNGLLTS
IAYGLNGEITYALEGSIFVAGSALQWLRDGMRMFRTAPESEEYAKKVESTENVYVVPAFT
GLGAPYWDQDARGAVFGLTRGTTKEHFIRATLESLAYQTKDVVDTMNKESGIPIKTLRVD
GGASKNDFLMQFQADILDTKIERSKISETTALGAAYLAGLATGFWKDQDEIKKYWEKDAT
FEPDMEEEEREDLYAGWQSAVEATRVFKHKSKRKDK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgtattacattattggagggaataaaatgacgaaagaatatattatgtcgatt
gatcaaggtactactagttctagagcaatcatatttgataaagcaggaaaccccaaatgg
agttctcaaaaagaattcactcaacattttcctcaaccaggttgggtagagcatgatgcg
aacgaaatttggatttcagttttatcagtcattgcaggcgttttgattgaatctggatta
aaaccatctgatattgatagtattggaattaccaaccaacgtgaaacaaccgttgtttgg
gataaagcaactggtagaccaatttaccgcgccattgtatggcaatcaaaacaaacaaat
gatattgcagatcaattaaaacaagatggacatacaaaattaattaaagataaaacggga
ttagtaatcgattcttacttctcagcaactaaaattaagtggatcttggatcatgttgaa
ggatcacgaaaacgtgctcaaaaaggcgaactcttatttggaacaatcgactcttggctg
gtgtggaaattaacaggcggaaaagctcatgttactgattattcaaatgcaagccgtacg
atgctgtttaatatttatgacctaaaatgggatgaagatattttagcattactagatatt
cccaaagaaatgttgccagaagtaaaatcttcttcagaagtatatggcaaaacgattcca
gaacatttctatggtggacaaattccaattgccggtatggcaggtgaccaacaagccgcg
ttattcggtcaagtaggatatgaaaaaggaatggttaaaaacacttatggcacaggtgcc
tttattattatgaacaccggaaaagaaccaattaaatcagacaatggactgcttacatcg
attgcttatggtttaaacggtgaaatcacttacgccttagaaggtagtatttttgtagct
ggatcagcactccaatggctaagagatggaatgagaatgttcagaacagctccagaatca
gaagagtatgctaaaaaagtggagtcaacagaaaatgtatatgtcgtaccagcatttaca
ggattaggagccccttattgggatcaagatgctcgtggagctgtctttggtttaacacgt
ggtacaacgaaagaacacttcatcagagcaacacttgaatcattggcttaccaaacaaaa
gatgttgtagatacaatgaataaagaatcaggcattccaattaaaacattgcgtgtggat
ggtggagcatcgaaaaatgacttcctgatgcaattccaagcagatattttagacactaaa
attgaacgctctaaaatcagtgaaacaacagctctaggtgctgcttaccttgctggatta
gcaacaggattttggaaagaccaagatgaaatcaaaaaatattgggaaaaagatgctaca
tttgaaccagatatggaagaagaagaacgtgaagatttgtatgcaggttggcaatcagct
gtagaagctacacgagtattcaaacataaatctaaaagaaaagataaataa

DBGET integrated database retrieval system