KEGG   Carnobacterium sp. 17-4: CAR_c01790Help
Entry
CAR_c01790        CDS       T01452                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:crn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178078..178929
Genome map
AA seq 283 aa AA seqDB search
MEIIEKAPAKINLSLDVLHKREDGYHEMKMVMTSVDLADRIVLKTIEEDRIVIHSTNGFL
PLDQRNHAYKAAKLLKDTYNIEKGVDITIEKNIPIAAGLAGGSSDAAATLRGLNRLWDLK
LTKDELATLGEKIGSDVPYCIYGGTAYATGRGEKIQQIQDIPQCWVVLVKPKKGISTWTV
FENLSFDQLIHPEIPQMLTAIQDNDYSQMVDSTGNALETVSAVKQPDIKRIKKKMIEFGA
DAALMSGSGPTIYALCKKYSKAQRVYNGLKGFCNEVYLVRTLK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggagatcatagaaaaggctcctgctaaaattaatttaagcttagatgttttgcataaa
agagaagatggttaccatgaaatgaagatggtaatgacttcagttgatttggcagatcgc
atagtgctaaaaacaattgaagaagatcgaatcgttattcactcaactaatggcttttta
ccattagaccagcgaaatcatgcatataaagctgcaaaactgttaaaggatacctataat
atcgaaaaaggtgtcgatattactatagaaaagaacattccgattgctgctggtttagcc
ggtggtagcagtgatgcggctgctaccttaagaggactgaatcgtttgtgggatttaaag
ttaacaaaagatgagctagctactctgggagaaaaaatcggctcagatgttccctattgt
atttatggtgggaccgcgtatgctaccggtcgtggagaaaaaattcaacaaatacaagat
atccctcagtgctgggtagtgctagttaaacctaaaaaaggtatttcgacttggactgtt
tttgaaaatctttcttttgatcagttgattcatccggaaatacctcaaatgttgactgct
attcaagacaatgattatagccaaatggttgatagtactggtaatgccttggaaactgta
tcagctgtaaagcaacccgatattaagcgaatcaaaaagaagatgattgagtttggagca
gatgctgctttgatgagtggaagtggtcctacaatttatgctttatgtaaaaaatattct
aaagctcagcgagtttataatggtttaaaaggattctgtaatgaggtctacttagtgcga
acactaaaataa

DBGET integrated database retrieval system