KEGG   Carnobacterium sp. 17-4: CAR_c02470Help
Entry
CAR_c02470        CDS       T01452                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
crn  Carnobacterium sp. 17-4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:crn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249788..250384
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLMDSYMKLPGIGAKTAARLAFFTIDMREEDVTDFAKSLISAKRDLHYCSNC
GQITEDDPCQICQDKSRDRSTVLVVEDPKDVMALEKMREYHGLYHVLHGVLSPIEGTGPE
DINIPSLIKRLQSDEINEVIIATNASAEGEATAMYLSRLIKPAGIKVTRLAHGLSVGSDI
EYADEITLLKAVEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccagaaccgatatcaaaattaatggacagttatatgaaactacctggaatt
ggagcaaaaacagctgctcgattagcctttttcactattgatatgcgtgaagaagatgta
acagattttgctaaatcattgattagtgcgaaaagagatttgcattattgctccaattgc
ggccaaattaccgaagatgatccctgtcaaatatgccaagataaatcgcgtgacagaagt
acagttttagtggtagaagatccaaaagatgtcatggcattagaaaaaatgcgtgaatat
catggactgtaccatgttttacatggcgttctttctccaatagaaggaaccggtccagaa
gatatcaatataccaagtttgatcaagagattgcagtctgacgaaataaatgaagtgatc
attgcaacgaacgcatctgctgaaggtgaagctacagcgatgtatttatcaagattaatc
aaaccagctggaatcaaagtaacacgattagctcacgggctttcagtgggaagcgatatc
gagtatgccgatgaaattacattgctgaaagcagtggaagggcgtagagaactttaa

DBGET integrated database retrieval system