KEGG   Carnobacterium sp. 17-4: CAR_c02640Help
Entry
CAR_c02640        CDS       T01452                                 

Gene name
proJ
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CAR_c02640 (proJ)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CAR_c02640 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CAR_c02640 (proJ)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CAR_c02640 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(264403..265224)
Genome map
AA seq 273 aa AA seqDB search
MKKMTTTSRQLLSSCKRIVVKVGTSTIMYPNGTINLQRLEKLAFVLSDLKNQGKEVILVS
SGAVGVGISRLHLSERPKTIPEQQAVASVGQTELMNLYSKFFFGYGQIIGQVLMTRDIVE
FPTSRLNAINTFEQLLVKGIIPIVNENDTVAVDELDHLTKFGDNDRLSAIVAEITDADLL
IMLSDIDGFYDKNPNDEPDAVLFDEIHTITDDLYALAGGKGSSYGTGGMSTKLIAANHIL
KNARQMVLANGEDPTIIFDIIEGKQIGTLFSAD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgacgactacttctcgacaattattatcttcttgtaaacgaatcgttgta
aaagttggaaccagcacgatcatgtatcctaatggtactattaatttacaacgtttagaa
aaattagcttttgtcttatctgatttaaaaaaccaaggaaaagaagtgattctagtctct
tctggagctgtaggagtgggaatctctcgtctgcatcttagcgaacgaccaaaaacgatt
cctgaacagcaagctgtagcttctgtaggacaaaccgaattgatgaatttatacagcaaa
ttcttttttggctatggacaaatcatcggtcaagttttaatgacacgagatattgtagag
tttccaactagccgtctaaatgcgatcaatacatttgaacaattgcttgtaaaaggtatt
attccaatcgtaaatgaaaatgatactgttgcagttgatgaattggatcatttgaccaaa
tttggtgataatgaccgtttatccgctattgttgcagaaattacggatgctgatttgctg
attatgttatcagatattgatgggttttatgataaaaacccaaatgatgagcctgacgct
gttctatttgatgaaatccacaccattacggatgacttatacgctcttgcgggcggaaaa
ggatccagctatggaactggcggaatgtctaccaagttgattgctgctaatcacatttta
aaaaatgcccgtcaaatggtgttagctaacggtgaagacccaacgattatttttgatatt
attgaaggcaaacaaattggaactttattctcagctgactaa

DBGET integrated database retrieval system