KEGG   Carnobacterium sp. 17-4: CAR_c03880Help
Entry
CAR_c03880        CDS       T01452                                 

Gene name
galF1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CAR_c03880 (galF1)
   00052 Galactose metabolism
    CAR_c03880 (galF1)
   00500 Starch and sucrose metabolism
    CAR_c03880 (galF1)
   00520 Amino sugar and nucleotide sugar metabolism
    CAR_c03880 (galF1)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CAR_c03880 (galF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396504..397385
Genome map
AA seq 293 aa AA seqDB search
MQKVRKAIIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEAINSGIEDILIVTGKS
KRPIEDHFDSNPELEANLKSKGKMELLELVEETTGLNLFFVRQSYPKGLGDAVLQAKAFV
GNEPFVVMLGDDLMEDEVPLTKQLINGYDKTHASNIAVMKVPHEETSKYGIIDVEGQVDE
TTYNVRRFVEKPNPEDAPSDLAIIGRYLLTPEIFDILETQEPGAGNEIQLTDAIDTLNKT
QRVFAHEFKGTRYDVGDKFGFLKTSIQYGLRHPEIKDSLNEYIIELGKKLEAE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtacgtaaagcgattatccccgcagcaggattaggaacacgatttttacca
gcaacaaaagctatggctaaagaaatgttaccaattgtagacaaaccaacgattcagttt
attgtagaagaagcaattaactctgggattgaggatattttaattgtaactgggaaaagc
aagcgacctattgaagaccactttgactcaaatccagaactggaagctaatctaaaatct
aaaggaaaaatggaacttttagaattagtcgaagaaacaactggcttaaatttatttttt
gttcgccaatcttatccaaaaggtttaggcgatgcagttttacaagccaaagcatttgtc
ggaaatgaaccatttgttgttatgcttggagatgatttaatggaagatgaagttccgcta
accaaacaactgattaacggatacgacaaaacccatgcatcaaatattgccgtaatgaaa
gtgcctcatgaggaaacctcaaaatatggaattattgatgtggaaggacaagtagacgaa
acaacttataatgttcgtcgttttgttgaaaaaccaaatccagaagatgcaccaagtgat
ttagcgatcattggacgttacttattaactcctgaaatctttgatattttagaaacacaa
gaaccaggtgctggaaatgaaattcaactaacggatgcaatcgatactctaaataaaacg
caacgtgtttttgcacatgagtttaaaggaacccgttatgatgttggagataaatttggc
ttcttgaaaacaagcatccaatatggcttgagacacccagaaataaaagattctttaaat
gaatacattattgaattaggcaaaaaattagaagctgaataa

DBGET integrated database retrieval system