KEGG   Carnobacterium sp. 17-4: CAR_c04020Help
Entry
CAR_c04020        CDS       T01452                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAR_c04020 (tpiA)
   01230 Biosynthesis of amino acids
    CAR_c04020 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c04020 (tpiA)
   00051 Fructose and mannose metabolism
    CAR_c04020 (tpiA)
   00562 Inositol phosphate metabolism
    CAR_c04020 (tpiA)
Enzymes [BR:crn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CAR_c04020 (tpiA)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CAR_c04020 (tpiA)
  Exosomal proteins of bladder cancer cells
   CAR_c04020 (tpiA)
  Exosomal proteins of melanoma cells
   CAR_c04020 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
411018..411773
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAEAAEFVEAVKTRIPSSEQVDSVIGSPALYLQSLVKASEGTELK
IAAQNSYFEEAGAFTGEISPAALGDLGVNYVIIGHSERREFFHETDEEINKKAHAIFKNG
MTPIICCGETLEQREAGETNEWVSGQVKAAIAGLTEGQIAESVIAYEPIWAIGTGKSSTS
KDANDTCAVIRQTIAKEVSQDAADAVRIQYGGSVKPENIAEYMAESDIDGALVGGASLEA
ESFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacctattattgctggtaactggaaaatgaacaaaacagctgctgaggctgct
gagtttgtagaagcagttaaaacaagaataccttcttctgaacaagtagattcagttatt
ggatctcctgctttatacttacaatcgttagttaaagcatcagaaggaacagaattaaaa
attgcagctcaaaacagctactttgaagaagctggagcattcacaggcgaaatcagtcct
gctgctttaggagacttaggagtaaactatgtaatcattggtcactctgagcgtcgtgaa
ttcttccatgaaacagatgaagaaattaataaaaaagcacatgctattttcaaaaatggt
atgactccaatcatttgctgtggtgaaacgttagaacaacgtgaagctggagaaacaaat
gaatgggtaagcggacaagttaaagcagcaattgctggcttaacagaaggtcaaatagct
gaatcagttattgcttatgaaccaatctgggcaatcggaactggcaaatcttctacttca
aaagacgcaaacgatacttgtgcagttattcgtcaaacaattgcaaaagaagtttctcaa
gatgctgctgatgctgtacgtattcaatacggcggaagtgtaaaacctgagaatattgct
gaatacatggctgaatcagatattgatggagctttagtaggaggagcaagcttagaagca
gaatcgttcttagcattattggaggctgttaaataa

DBGET integrated database retrieval system