KEGG   Carnobacterium sp. 17-4: CAR_c04110Help
Entry
CAR_c04110        CDS       T01452                                 

Gene name
yvaK
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
crn  Carnobacterium sp. 17-4
Brite
Enzymes [BR:crn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CAR_c04110 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
423161..423913
Genome map
AA seq 250 aa AA seqDB search
MAIKSFFFEKGPQAVILMHAYSSTPNDVRMLGRALEKENYTVYAPLFKGHGTMEPEDILD
ASPNDWIEDAKEAIRFLQKKGYEEIVVFGLSLGGIIATKMVVDKEPVIAGGTFCSPVIDF
HKGNNVREEFLTFVRILKKKAGYSETDIDNRMPEVELKLDNQLNEISELTKSMKAHYSEI
THPFFIAQAGQDEMIDPQVAVAFKEALTQAPVVDFHWYENSKHAVTVGVDRKALQEDVSN
FLKQLDWNGG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaaatcatttttttttgaaaaggggcctcaagccgtcattttgatgcatgcc
tactctagtacacctaatgatgtacggatgttgggaagagcgttggagaaagaaaattat
accgtttatgcgccgttattcaaaggacatggcacaatggaaccagaggatattttagat
gcctcaccaaacgattggatagaagatgcaaaagaagccatccgttttttacaaaaaaag
ggctacgaagaaattgtggtatttggtctgtctttaggcggaatcatagcgactaaaatg
gtagtcgataaagaaccagtaatagctggtggcacgttttgctcaccagtgattgatttt
cataaaggcaataacgtgagagaagaatttttaacttttgtgcgtatactgaaaaagaaa
gcaggttattctgagacagatatagataaccgcatgccagaagtagaactaaaattagat
aaccaattaaacgaaataagtgaactaacaaaatcaatgaaggctcattatagtgagatt
acacatcccttttttattgcacaagctggtcaagatgaaatgattgatccacaagttgct
gtcgcatttaaagaagcattaacacaagctcccgtagttgattttcattggtatgaaaac
agtaaacatgcggtaacggtaggtgtagatagaaaagccttgcaagaagatgttagcaac
tttttaaaacagttagattggaatggaggataa

DBGET integrated database retrieval system