KEGG   Carnobacterium sp. 17-4: CAR_c04140Help
Entry
CAR_c04140        CDS       T01452                                 

Gene name
bsaA
Definition
putative peroxidase (EC:1.11.1.12 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CAR_c04140 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CAR_c04140 (bsaA)
Enzymes [BR:crn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CAR_c04140 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426864..427355
Genome map
AA seq 163 aa AA seqDB search
MKEGLTMSVYDYTVTEIGGEEVSLSEYKGKVLLIVNTATECGLAPQLEGLEKLYQTYKEQ
GLVILGFPSNQFMNQEPREGEEIASFCQKNYGVSFQFHEKILVNGKNADPLYHYLTSETG
NKKIKWNFTKFLIGRDGEIIKRFGSTKVPEKMETDIAEAVTNS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaggactaacaatgtctgtttacgattatacggttactgaaattggtggggaa
gaagtttcgctatcagaatacaaaggaaaagttttactaattgtgaatacagctacagaa
tgtggtttggctcctcaattagaaggtttagaaaaattgtatcaaacgtataaagaacaa
ggactagttatactaggtttcccttctaatcagtttatgaatcaagaacctcgtgaaggt
gaagaaatcgcaagtttttgtcaaaaaaattatggtgtttcttttcagtttcatgaaaaa
atattggtgaatgggaaaaatgcagatccactttaccactatcttacatcagagacaggg
aacaaaaaaatcaaatggaatttcacaaaatttctaattggtcgagatggtgaaatcatt
aaacgatttggttcaacaaaggtacctgaaaaaatggaaacggatatagctgaagcagta
acaaatagttaa

DBGET integrated database retrieval system