KEGG   Carnobacterium sp. 17-4: CAR_c04150Help
Entry
CAR_c04150        CDS       T01452                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:crn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:crn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:crn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:crn00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:crn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427531..429525
Genome map
AA seq 664 aa AA seqDB search
MNTTKKYLNLLAKEYPTIGDTTTEIINLEAIMNLPKGTEHFVSDVHGEYESFQHVLRNGS
GNVKEKIREIFHNRLSQREMNSLATLIYYPENKIRLVCNDFENQEEVHEWYRITLSRLIE
LCVFVASKYTRSKVRKALPNEFAYIIEELLSKDGDGYTNKEDYYSEIIGSIISLDRGTDF
ITAISYLIQRLVVDQLHVVGDIYDRGPYPDKIIDTLMEHHSVDVQWGNHDILWMGAASGS
AVCIANVLRISARYDNLEIIEDAYGISLRQLLTFAEMTYPEDLKSCFYPKVDSNKEDYFE
DEIRQITKMHQAISVIQFKLEGEIINRHPEFQLDHRLVLNGIDYENGTISIKGKDYPLLN
TNFPTIDPADPYKLTLEEEFVVEKLITAFKNCGRLQHHISYLYSKGNMYLTYNDNLLFHG
CMPLTETGEFMGMEIQGEQYAGKKLLDKFEEVLRKGYLNKGHKDNDKYLDYIWYLWTGPV
SSLFGKDQMTTFERYYVADKVTHEEKKNAYYAMRNDEKTCEKILSEFGLDPLKGHIINGH
TPVKEKRGEDPIKANGRIIVIDGGFSKAYQGTTGLAGYTLLYNSYGMVLVSHQPFTSVND
AIENEIDIMSTRRVIDRELDRKKVRETDVGKELTKQVSDLKELLEAYRNGDIIEKPKQNY
TILK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaactaaaaaatatttgaatttattagctaaagaatacccaacgattggggat
acaactactgaaatcatcaatctggaagctattatgaatttacctaaaggtacggaacat
tttgttagcgatgttcatggagaatacgagtcttttcaacatgtgcttagaaatggatca
ggtaatgtaaaagaaaagataagagaaatttttcataatcgcttaagccaaagagaaatg
aacagcttagcaacattaatttattatcctgaaaataaaattcgattggtctgtaatgat
tttgaaaatcaagaagaagtacatgaatggtataggattacactgtctagattaatagaa
ttatgtgtttttgtagcttcaaagtacaccaggtcaaaagtccgaaaggctttgccaaat
gaatttgcgtatattattgaagagctgttatcaaaagatggagatggctatacaaataaa
gaagattactacagtgaaattattggcagcatcatttcattggatagaggaactgatttt
attacagctatatcctatctgatccaaaggcttgtagtggatcaattgcatgttgttggg
gatatttatgacagaggtccttaccctgataaaattattgatacactaatggaacatcat
tcggtggatgtacaatggggaaaccatgatatcttgtggatgggagcagcaagtggttca
gcggtttgtattgcaaatgtcctgcgcatcagtgctcgctatgataatttagaaattatt
gaagacgcttacggcatttcgttacgtcaattgcttacttttgcggaaatgacgtatcca
gaagacctaaaaagttgtttttatcctaaagtggattcaaataaagaagattattttgaa
gatgaaattcgccaaatcaccaaaatgcatcaagctatttcagtgattcagtttaaactt
gagggtgaaatcattaacagacatcctgagtttcaattagaccaccgattagtgttaaac
ggaattgattatgaaaatgggacaatttcaatcaaaggaaaagattacccgttattaaat
accaattttccaacgattgatccagctgatccttataaattaactttagaagaagagttt
gttgttgaaaaattaatcacagcatttaaaaattgtgggcgcctgcagcatcatatttct
tatttgtacagcaaaggcaatatgtacctcacgtataatgataatttattgttccatggc
tgtatgcctctgacggaaaccggtgagtttatgggaatggaaatccaaggggagcaatac
gctggaaaaaaattattggacaagtttgaggaagtactacgaaaagggtatttaaataaa
ggccataaagacaatgacaagtatttagactacatttggtatttatggaccggtccagta
tcttcactttttggaaaagatcaaatgacgacattcgaacggtattacgttgcggataaa
gttactcatgaagaaaagaaaaatgcttattatgctatgcgcaatgatgaaaaaacatgc
gaaaagattttaagtgagtttggattagatcctcttaaagggcatatcattaatggacac
acccccgtgaaagaaaaacgcggagaggatcctataaaggcgaatggccggatcattgtc
attgatggcggattttctaaagcgtatcaagggacaactgggttagcagggtataccttg
ttgtacaactcctatggaatggttttagtttctcatcaaccgttcacttctgtaaatgac
gcgattgaaaatgaaatagacatcatgtctaccagaagagtgattgaccgagaattagac
cgtaaaaaggttcgagaaaccgatgtgggtaaagaactgactaagcaagttagtgatttg
aaagaattattagaagcttatcgtaatggagatatcattgaaaagccaaaacagaattac
accattcttaagtaa

DBGET integrated database retrieval system