KEGG   Carnobacterium sp. 17-4: CAR_c05690Help
Entry
CAR_c05690        CDS       T01452                                 

Gene name
pepV
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CAR_c05690 (pepV)
  Amino acid metabolism
   00300 Lysine biosynthesis
    CAR_c05690 (pepV)
Enzymes [BR:crn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CAR_c05690 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574082..575482
Genome map
AA seq 466 aa AA seqDB search
MAIDWKKEAADRKEDFLADLIELLKIDSVRDDIKATADAPVGPGPKKALEAFLALGERDG
FVTKNVGNLAGHIEYGSGDETMGVFAHVDVVPVGTGWETDPFSPIIKDNRIYARGSSDDK
GPGVAAYYALKMIKDLELPVSKKIRFIIGTDEESGWMCMDHYLAHEPIPDFGFSPDAEFP
IINGEKGILTVYVNTKGNNKGGKNELISFDAGLRENMVPQDATAIFTTQEAEQIEKDFYD
FVEVSPITGTIKVIGDQVTIEVGGKAAHGMAPHLGVNAGTYLAAFLNRYSFGGDAKNFLQ
LTTEYLHEDTKAGKLGLNYIDDVMGDLTMNSGVFTFTPEDGGVIAVNLRFPKGVTPEGIE
IKMESKLAEFGVTLSRGKEQMPHYVSAEDPLVKTLLDVYQRQTGLEAHEQTIGGGTYGRL
LERGVAYGAMFPNSIDTMHQANEFMAIDDLMNAMSIYAEAIYELIK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgattggaaaaaagaagctgctgatcgaaaagaagattttttagcagactta
atagaattacttaaaattgacagcgtccgcgatgatataaaagctacagctgatgcacca
gtaggtccaggaccgaaaaaagcgttggaagcattcttggctttaggagaaagagatggc
tttgttactaagaacgtggggaacttagctggacatattgaatacggtagtggagacgaa
acaatgggtgtttttgctcacgtggatgtagtcccagttggaacaggttgggaaactgac
ccattcagtcctataatcaaagataaccgtatctatgctcgtggttctagtgatgataag
ggacctggtgtggctgcttattatgctttgaaaatgattaaagatttagaacttccagtt
tctaaaaaaattcgctttattattgggacagatgaagaaagcggctggatgtgtatggat
cattacttagctcatgaaccgattccagactttggtttttcaccagatgcagaatttcct
atcattaacggtgaaaaaggaatcttgactgtctatgtaaacacaaaagggaataacaaa
ggcggaaaaaatgagttgatcagttttgatgctggtttgcgtgaaaatatggtaccacaa
gatgctactgctatttttacaactcaagaagctgaacaaattgaaaaagatttttatgat
tttgttgaagtttccccaattactggaacgataaaagtaattggtgatcaagttacgatt
gaagtaggaggaaaagcagctcacggtatggcaccacatctaggtgttaatgctggaact
tatctagctgcattcttaaaccgttattcatttggtggagatgctaaaaacttcttacaa
ctgacaacggaatatttacatgaagatacaaaagctggaaaattaggattgaactatatc
gatgacgttatgggagatcttactatgaattcaggcgtatttacgttcacacctgaagac
ggtggagtaattgcagtgaatctgcgcttccctaaaggcgtaacacctgaaggaatcgaa
atcaaaatggaaagcaagcttgcagaattcggagtaacacttagccgaggcaaagaacaa
atgccgcattatgtatctgctgaagatccactagtgaaaacattgctagatgtttatcaa
agacaaactggcctagaagctcacgaacaaacaattggtggcggaacgtatggacgcttg
ttagagcgtggagtagcttatggagctatgttccctaacagcattgatacaatgcaccaa
gccaatgaatttatggctattgatgacttgatgaacgcaatgagtatatacgcagaagca
atctacgagttgattaaataa

DBGET integrated database retrieval system